Rahnella aceris Y9602: Rahaq_0401 Help Entry Rahaq_0401        CDS       T01422                                  Name (GenBank) Chaperonin Cpn10   KO K04078   chaperonin GroES Organism rah  Rahnella aceris Y9602 Brite KEGG Orthology (KO) [BR:rah00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rah03110]     Rahaq_0401    03029 Mitochondrial biogenesis [BR:rah03029]     Rahaq_0401 Chaperones and folding catalysts [BR:rah03110]  Heat shock proteins   HSP10    Rahaq_0401 Mitochondrial biogenesis [BR:rah03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     Rahaq_0401 SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  ADW72031 LinkDB All DBs Position 431427..431720 Genome browser AA seq 97 aa AA seqDB search MKIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEILAVGHGRILENGEVKALDVK VGDIVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcgtccattgcatgaccgcgttatcgtcaagcgtaaagaagtagaatctaaa tccgctggcggcatcgttctgactggctccgctgccggtaaatctacccgtggcgaaatc ctggctgtcggccatggtcgcattctggaaaatggtgaagttaaagcgctggacgtgaaa gttggcgacatcgtcattttcaacgacggttacggcgtgaaagctgagaagatcgacaat gaagaagtgttgatcatgtctgagagtgacattctggcaatcgtagaagcctga

DBGET integrated database retrieval system