Rahnella aceris Y9602: Rahaq_0898 Help Entry Rahaq_0898        CDS       T01422                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism rah  Rahnella aceris Y9602 Pathway rah01100   Metabolic pathways rah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rah00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Rahaq_0898    00074 Mycolic acid biosynthesis     Rahaq_0898   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Rahaq_0898 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADW72523 UniProt:  A0A0H3F6M6 LinkDB All DBs Position 967168..967425 Genome browser AA seq 85 aa AA seqDB search MDSLSNDIKALIIETLNLEGMTPDEIETQAPLFGDGLGLDSIDALELGLALKKQYGVILS AESQEMREHFYSVESLARFISVQRG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggattcattaagtaacgacataaaagcacttatcattgagacgctgaatctggaagga atgacgccagatgagatagagacgcaggccccactttttggtgacggattagggctggat tctattgatgcccttgagcttggtctggcattaaagaagcaatacggtgtgatcctttcg gcggaaagtcaggaaatgcgcgagcacttttattctgttgaaagtttggccagatttata tcagtacagcgtggttaa

DBGET integrated database retrieval system