Rahnella aceris Y9602: Rahaq_2885 Help Entry Rahaq_2885        CDS       T01422                                  Name (GenBank) DNA polymerase II beta subunit   KO K02345   DNA polymerase III subunit theta [EC:2.7.7.7] Organism rah  Rahnella aceris Y9602 Pathway rah03030   DNA replication rah03430   Mismatch repair rah03440   Homologous recombination Brite KEGG Orthology (KO) [BR:rah00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     Rahaq_2885    03430 Mismatch repair     Rahaq_2885    03440 Homologous recombination     Rahaq_2885  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rah03032]     Rahaq_2885    03400 DNA repair and recombination proteins [BR:rah03400]     Rahaq_2885 Enzymes [BR:rah01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      Rahaq_2885 DNA replication proteins [BR:rah03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      Rahaq_2885 DNA repair and recombination proteins [BR:rah03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      Rahaq_2885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_theta Motif Other DBs NCBI-ProteinID:  ADW74480 UniProt:  A0A0H3FEH8 LinkDB All DBs Position 3132222..3132452 Genome browser AA seq 76 aa AA seqDB search MSINLAEISKEEMDRINVDLAASAVAFKERYNMPVVAEMAEREQPAHLRTYFRERVMFYR GESHKFSRLPYEPKQK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcatcaatctggctgaaatcagcaaagaagaaatggatcgtatcaatgtcgatctt gcggcctcagcggtggcctttaaagaacgctacaacatgccggttgtcgctgagatggcg gaacgcgagcagcctgcgcatctgcgcacctattttcgtgagcgggtgatgttctatcgc ggggaatcacataagttctcccgcttaccttatgagccgaagcaaaagtaa

DBGET integrated database retrieval system