Rahnella aceris Y9602: Rahaq_3834 Help Entry Rahaq_3834        CDS       T01422                                  Name (GenBank) DNA polymerase III psi subunit   KO K02344   DNA polymerase III subunit psi [EC:2.7.7.7] Organism rah  Rahnella aceris Y9602 Pathway rah03030   DNA replication rah03430   Mismatch repair rah03440   Homologous recombination Brite KEGG Orthology (KO) [BR:rah00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     Rahaq_3834    03430 Mismatch repair     Rahaq_3834    03440 Homologous recombination     Rahaq_3834  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rah03032]     Rahaq_3834    03400 DNA repair and recombination proteins [BR:rah03400]     Rahaq_3834 Enzymes [BR:rah01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      Rahaq_3834 DNA replication proteins [BR:rah03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      Rahaq_3834 DNA repair and recombination proteins [BR:rah03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      Rahaq_3834 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_III_psi CSTF_C Motif Other DBs NCBI-ProteinID:  ADW75423 UniProt:  A0A0H3FGZ5 LinkDB All DBs Position complement(4178316..4178729) Genome browser AA seq 137 aa AA seqDB search MASRRDTLLQQLGITQWTLRRPAVLQGEVAVSLPAGTKLLIVAAVPPAEDDPLVSDVLRS LTLKESEVYRLTPEQVTMLPEDTRCNIWRLGVSEPLTLTGPQLSTPALAELYQDAGAKRA LWQQICENEQHFYPDAR NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggcatccagacgagatacattattacaacagctgggcattacccagtggacgctgcgc cggcctgctgtattacaaggcgaagtggcagtcagtctgcccgcgggaactaaattgctg atcgtcgccgccgttccgccagcagaagatgatccgctggtcagcgatgttttgcgcagc ctgacgctaaaagaatcagaagtttaccgcctgacgcctgaacaggtcactatgttacct gaagatacccgctgcaatatctggcgactgggggtaagcgaaccgctgactctcactggc ccgcagctctccactccggccctggccgaactctatcaagacgccggcgccaaacgcgcg ctctggcagcagatctgtgaaaatgaacaacatttctatcctgacgcccgctga

DBGET integrated database retrieval system