KEGG   Rothia aeria: RA11412_1241
Entry
RA11412_1241      CDS       T05268                                 
Name
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
raj  Rothia aeria
Brite
KEGG Orthology (KO) [BR:raj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:raj03016]
    RA11412_1241
Enzymes [BR:raj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     RA11412_1241
Transfer RNA biogenesis [BR:raj03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    RA11412_1241
 Prokaryotic type
    RA11412_1241
SSDB
Motif
Pfam: TruB_N TruB_C TruB_C_2 PseudoU_synth_2 AIRC DKCLD DUF4402
Other DBs
NCBI-ProteinID: BAV87540
UniProt: A0A2Z5QZ14
LinkDB
Position
1136102..1137250
AA seq 382 aa
MAKTKGDGPSGLVVIDKPEGITSHDVVSKLRWIAGTRRVGHAGTLDPAATGVLILGLNKA
TKLLTYLVGQDKTYQATIQLGISTETDDAQGRQTGTCPEAVEALTEQRILEAVASLTGDI
MQVPSAVSAIKVNGVRSYTRVRSGEQVELAARPVRVNEFTVHSIQRTMTSWCVLVSQQEL
AEAGIDAAGTHGELSDPTTAITSVPVINCEVTVSCSSGTYIRALARDLGQMLGTGGHLIR
LRRTRVGGTTLADAAALPELLERREAAGQPLTDMPLLSLEEAARRLFKVRELSAQQATDV
SFGRRISPNGDGTVTLRQAHASTGDGGEKQHATTEGVYAAFAPDGTLVALLENLKQRGSV
VAAPTLVFEAGTDFSGTLEKSS
NT seq 1149 nt   +upstreamnt  +downstreamnt
gtggctaaaacgaaaggggacggacccagcgggctggtagtgatcgataagcccgagggg
ataaccagccacgatgtggtgtcgaaactccgctggattgcgggcacccgtcgcgttggt
catgcgggcacccttgacccggcggccaccggggtgctgattctggggctgaataaggcg
acgaaactgctgacctacctggtagggcaggataagacgtatcaggccacgattcagctg
ggcattagcacagaaacggacgacgcgcagggccgacagaccggaacttgcccggaggct
gtggaggcactgactgagcagcgcattcttgaggcggtcgcaagcttaaccggcgatatt
atgcaggtgccttctgcggtatctgccatcaaggttaatggggtccgctcttacactcgg
gtgcgcagcggtgaacaggtagaactagctgcccgcccggtgcgggtgaatgagttcacg
gtgcattccatacaacgcactatgaccagttggtgtgttctcgtttctcagcaggaactt
gccgaggcggggatcgacgcggctggaacacacggcgagctgtcagatcccactactgcg
atcacctcggtgccggtgatcaactgtgaggtgacggtatcctgctcctcaggcacctat
attcgtgccttggcgcgggatctgggtcagatgctgggcaccggcgggcacctcatacgt
ttacgccgcacccgggtgggaggaaccacccttgcagacgccgctgctttgccggaactg
ctggaacgccgggaggcggcggggcaaccgttgacggatatgccgctgctgagtttagag
gaggctgcgcgccgtctctttaaggttcgtgagctatcggcgcagcaggccacagatgtg
tcttttggccgccgcattagcccgaacggggacgggacggtgactctgcggcaggcccac
gcaagtaccggtgacggaggggaaaagcaacacgctactaccgagggcgtgtacgcggct
tttgcgccggatggcacgctggtggcgttgctggagaacttaaaacagcgcggtagcgtg
gtggctgcaccgaccctggtgttcgaggctgggactgatttttccggaacattggagaag
agctcatga

DBGET integrated database retrieval system