Rickettsia amblyommatis GAT-30V: MCE_01730 Help Entry MCE_01730         CDS       T01787                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism ram  Rickettsia amblyommatis GAT-30V Brite KEGG Orthology (KO) [BR:ram00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ram03032]     MCE_01730    03036 Chromosome and associated proteins [BR:ram03036]     MCE_01730    03400 DNA repair and recombination proteins [BR:ram03400]     MCE_01730 DNA replication proteins [BR:ram03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     MCE_01730 Chromosome and associated proteins [BR:ram03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     MCE_01730 DNA repair and recombination proteins [BR:ram03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       MCE_01730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding ATP-sulfurylase HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AFC69351 UniProt:  H8K4A7 LinkDB All DBs Position 307832..308164 Genome browser AA seq 110 aa AA seqDB search MSTHNKKEQKKMNKTEFIAFMTDYGHNHKHASHKTLTKAEAEKALNLVLDSVIGAIKSHH NINITGFGSFEIHHRKAREGRNPKTGAKMKIDAYNQPTFRAGRKMKEACN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgagtacacataacaaaaaagaacaaaaaaaaatgaataaaaccgaatttatagcattt atgaccgactatggtcataatcataaacatgcttcacacaaaacattaacaaaagctgag gccgagaaagcacttaatttggttcttgatagtgtgattggtgctataaagagccaccat aatattaatataacaggttttggttcatttgaaatacatcatagaaaagcacgtgagggt cgtaacccaaaaaccggagcaaaaatgaaaatagatgcttacaatcaacctacttttaga gccggaagaaaaatgaaagaagcttgtaattaa

DBGET integrated database retrieval system