KEGG   Rhodococcus antarcticus: RHODO2019_04190
Entry
RHODO2019_04190   CDS       T09186                                 
Name
(GenBank) acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
rant  Rhodococcus antarcticus
Pathway
rant00290  Valine, leucine and isoleucine biosynthesis
rant00650  Butanoate metabolism
rant00660  C5-Branched dibasic acid metabolism
rant00770  Pantothenate and CoA biosynthesis
rant01100  Metabolic pathways
rant01110  Biosynthesis of secondary metabolites
rant01210  2-Oxocarboxylic acid metabolism
rant01230  Biosynthesis of amino acids
Module
rant_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
rant_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:rant00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RHODO2019_04190
   00660 C5-Branched dibasic acid metabolism
    RHODO2019_04190
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    RHODO2019_04190
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    RHODO2019_04190
Enzymes [BR:rant01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     RHODO2019_04190
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_M TPP_enzyme_N CO_dh
Other DBs
NCBI-ProteinID: UZJ25660
UniProt: A0ABY6P1X8
LinkDB
Position
846718..848604
AA seq 628 aa
MSAPTARPQATARPARPATPPAAPRRPASAPERVTGAQSLVRSLEEVGCEIIFGIPGGCI
LPVYDPLLDSTRVRHVLVRHEQGAGHAATGYAQATGKVGVCMATSGPGATNLVTPLADAH
MDSVPIVAITGQVNSAFIGTDAFQEADISGITMPITKHNFLVTDPADIPRAVAEAFHIAS
TGRPGPVLVDIPKDVLQAQTTFSWPPELRLPGYRPITKPHGKQVREAARLIAAARRPVLY
VGGGVIKAQACAELAELAELTGAPVVTTLMARGAFPDSHPQNLGMPGMHGTVAAVAALQR
SDLLVTLGARFDDRVTGQLATFAPGAKVIHADIDPAEIGKNRIADVPIVGDAREVLGELV
ETLRASTDPRPDLAEWWRQLDGIRSTYPLGYDRPSDGALSPELVIERIGRAAGPDAIYCA
GVGQHQMWAAQFISYEKPRTWLNSGGLGTMGYAVPAAMGAKMGMPDTEVWAIDGDGCFQM
TNQELATCAIEGVPIKVAVINNGNLGMVRQWQTLFYGERYSNTDLSTHQTATNRRIPDFL
LLAEALGCVGFRCEREEDVDDVIAAARAITDRPVVIDFVVGADAQVWPMVAAGTGNDEIM
AARGIRPLFDVDDASPEIIAAASPEDEQ
NT seq 1887 nt   +upstreamnt  +downstreamnt
gtgagtgctcccaccgcccgcccgcaggccaccgcgcggcccgcgcgcccggccacccca
cccgccgctccacgccgcccggcctcggcccccgagcgcgtcaccggcgcgcagtcgctc
gtgcgctccctggaggaggtgggctgcgagatcatcttcggcatcccggggggctgcatc
ctgccggtgtacgacccgctgctcgactccacccgggtccgccacgtgctcgtccggcac
gagcagggcgcgggccacgccgccacgggctacgcgcaggccaccggcaaggtcggggtc
tgcatggccacctcggggcccggcgcgacgaacctggtgaccccgctggcggacgcgcac
atggactcggtgcccatcgtcgccatcaccgggcaggtcaactccgcgttcatcggcacc
gacgcgttccaggaggccgacatctccggcatcacgatgccgatcaccaagcacaacttc
ctcgtcaccgatccggccgacatcccgcgagccgtcgccgaggccttccacatcgcgagc
accggccgccccggccccgtcctggtcgacatccccaaggacgtcctccaggcccagacc
acgttcagctggccgcccgagctgcggctgcccggctaccgccccatcaccaagccgcac
ggcaagcaggtccgcgaggcggcccggctgatcgccgccgcccggcggcccgtgctctac
gtcggcggcggcgtcatcaaggcgcaggcctgcgccgagctggccgagctggccgagctg
acgggcgcgcccgtggtcaccacgctgatggcccgcggtgccttccccgacagccacccg
cagaacctcggcatgcccggcatgcacggcacggtcgccgcggtggcggcgctgcagcgc
agcgacctgctggtcaccctcggtgcccgcttcgacgaccgggtcaccggacagctcgcg
accttcgcccccggggccaaggtcatccacgccgacatcgaccccgcggagatcggcaag
aaccgcatcgcggacgtccccatcgtcggcgacgcccgcgaggtgctcggcgagctggtg
gagaccctgcgcgcgagcaccgacccgcggcccgacctcgcggagtggtggcgccagctc
gacggcatccgcagcacctacccgctgggctacgaccggccgagcgacggcgccctctcc
ccggagctggtcatcgagcggatcggacgagctgcgggtccggacgcgatctactgcgcg
ggcgtcgggcagcaccagatgtgggcggcccagttcatctcctacgagaagccccgcacc
tggctcaactccggtggcctggggaccatgggctacgccgtgcccgccgccatgggcgcc
aagatgggcatgcccgacaccgaggtgtgggccatcgacggtgacggctgcttccagatg
accaaccaggagctggcgacctgcgcgatcgagggcgtgcccatcaaggtggccgtcatc
aacaacggcaacctgggcatggtgcggcagtggcagaccctgttctacggggagcggtac
tccaacaccgacctctccacccaccagacggcgaccaaccgccgcatccccgacttcctg
ctgctcgccgaggcgctgggctgcgtcgggttccgctgcgagcgcgaggaggacgtggac
gacgtcatcgcggccgcccgggcgatcaccgaccggcccgtcgtgatcgacttcgtggtc
ggcgcggacgcccaggtctggccgatggtcgccgccggcaccggcaacgacgagatcatg
gccgcccggggcatccggcccctgttcgacgtcgacgacgcctcgcccgagatcatcgcg
gccgccagcccggaggacgagcagtga

DBGET integrated database retrieval system