Rhodococcus antarcticus: RHODO2019_10675 Help Entry RHODO2019_10675   CDS       T09186                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rant  Rhodococcus antarcticus Pathway rant01100   Metabolic pathways rant01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rant00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RHODO2019_10675    00074 Mycolic acid biosynthesis     RHODO2019_10675   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RHODO2019_10675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UZJ23673 LinkDB All DBs Position 2223497..2223736 Genome browser AA seq 79 aa AA seqDB search MSNDEITAGFAEIIEEVVGIEAADVTPEKSFVDDLDIDSLSMVEIAVQTEDRFGVKIPDE ELANLKTVGDAVDYIAKNK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt gtgagcaacgacgagatcaccgccggcttcgccgagatcatcgaggaggtcgtcggcatc gaggcggccgacgtcaccccggagaagtccttcgtcgacgacctggacatcgactccctg tcgatggtcgagatcgccgtccagaccgaggaccgcttcggcgtgaagatccccgacgag gagctcgcgaacctcaagaccgtcggtgacgcggtggactacatcgcgaagaacaagtga

DBGET integrated database retrieval system