Raoultella sp. X13: DSD31_01555 Help Entry DSD31_01555       CDS       T05540                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rao  Raoultella sp. X13 Pathway rao01100   Metabolic pathways rao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSD31_01555    00074 Mycolic acid biosynthesis     DSD31_01555   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSD31_01555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AXC28230 LinkDB All DBs Position complement(333626..333883) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIITTLNLEELSADDIDTDAALFGDGLGLDSIDALELGLAVKNRYGVVLS AESDEMRQHFFSVATLAAFIDAQRT NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaaaaatctcataattactacgttgaatctggaagaa ctgtcggctgacgacattgacaccgatgcggcactctttggcgatggcctgggtctggat tccatcgacgccctggagctggggctggcggtaaaaaaccgctacggcgtggtgctctcc gccgaaagcgacgagatgcgccagcatttcttctccgttgccaccctggccgcgtttatc gacgctcaacgtacctga

DBGET integrated database retrieval system