Raoultella sp. X13: DSD31_15810 Help Entry DSD31_15810       CDS       T05540                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rao  Raoultella sp. X13 Pathway rao01100   Metabolic pathways rao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSD31_15810    00074 Mycolic acid biosynthesis     DSD31_15810   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSD31_15810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AXC30831 LinkDB All DBs Position complement(3327544..3327780) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccactgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system