Rickettsia asiatica: RAS_13220 Help Entry RAS_13220         CDS       T06307                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ras  Rickettsia asiatica Pathway ras01100   Metabolic pathways ras01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ras00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RAS_13220 (acpP)    00074 Mycolic acid biosynthesis     RAS_13220 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RAS_13220 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L50 DUF1493 PP-binding_2 Motif Other DBs NCBI-ProteinID:  BBJ32213 UniProt:  A0A510G8J6 LinkDB All DBs Position 1159440..1159685 Genome browser AA seq 81 aa AA seqDB search MSTTDKIEQKVIEMVAEKLNKDKSIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPD DEATKIKTVSDVIKYIKERQS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtacaacggacaagatcgaacagaaagttattgaaatggttgctgaaaagctaaat aaagataaatcgataataactacggattcaagatttatagaagatttgaaagctgatagc cttgataccgtagagttaatgatggcaatagaagttgaatacggtattgatatccctgat gatgaagccactaaaattaaaaccgtatccgatgttataaaatatatcaaagaacgccaa tcttaa

DBGET integrated database retrieval system