Riemerella anatipestifer CH3: M949_1378 Help Entry M949_1378         CDS       T03250                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rat  Riemerella anatipestifer CH3 Pathway rat01100   Metabolic pathways rat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rat00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M949_1378    00074 Mycolic acid biosynthesis     M949_1378   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M949_1378 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 ACP_SdgA_C PP-binding_2 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  AIH02546 LinkDB All DBs Position 1410960..1411199 Genome browser AA seq 79 aa AA seqDB search MSDIASRVKAIIADKLDVEETEVTPEASFTNDLGADSLDTVELIMEFEKEFNIQIPDDQA EKITTVGHAIAYVEEVVNK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcagacattgcatcaagagtaaaagcgattatcgcagataagttagatgtggaggaa acagaagtaactccagaagctagtttcactaatgatttaggagcagattcgctagatact gtggagcttattatggaatttgaaaaagaattcaatatccaaatccctgatgatcaagcg gagaaaatcactacagtagggcacgcaattgcttatgtagaagaagtggtaaataaataa

DBGET integrated database retrieval system