Riemerella anatipestifer CH3: M949_1614 Help Entry M949_1614         CDS       T03250                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rat  Riemerella anatipestifer CH3 Pathway rat01100   Metabolic pathways rat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rat00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M949_1614    00074 Mycolic acid biosynthesis     M949_1614   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M949_1614 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding_2 PP-binding Motif Other DBs NCBI-ProteinID:  AIH02781 LinkDB All DBs Position 1664751..1664981 Genome browser AA seq 76 aa AA seqDB search MKEKIIKIMAEVFEMDENSFPQEISQETVENWDSLRHLNLIVEIEESFDVSFEPEEISEM ITMDKILEMLQKQGKQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaaagagaaaataattaaaataatggcagaagtttttgagatggatgagaatagcttt ccacaagaaatttcacaagaaacggtagaaaattgggattcgctccgtcatcttaacctt attgtagagatagaagagtcttttgatgtatcttttgagccagaagaaatttccgaaatg attactatggacaagattttggaaatgcttcaaaaacagggaaaacaataa

DBGET integrated database retrieval system