Rathayibacter sp. VKM Ac-2759: GSU68_08945 Help Entry GSU68_08945       CDS       T10520                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism rath  Rathayibacter sp. VKM Ac-2759 Pathway rath01056   Biosynthesis of type II polyketide backbone rath01100   Metabolic pathways rath01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rath00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     GSU68_08945    00253 Tetracycline biosynthesis     GSU68_08945  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:rath01004]     GSU68_08945    01008 Polyketide biosynthesis proteins [BR:rath01008]     GSU68_08945 Lipid biosynthesis proteins [BR:rath01004]  Polyketide synthase   Component type    GSU68_08945 Polyketide biosynthesis proteins [BR:rath01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      GSU68_08945     Nonaketide PKS      GSU68_08945     Decaketide PKS      GSU68_08945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QHC66683 UniProt:  A0A6P1FBJ2 LinkDB All DBs Position 1948209..1948475 Genome browser AA seq 88 aa AA seqDB search MNDTFTLDALMTLLTRKAGLPLSAHTDDPDARFSDVDLDSLAFLEMQTALAETYGVELPD DQTERYTFGEIVDLVQDRLAERSVERAR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaacgacaccttcaccctcgacgccctgatgacgctgctgacccggaaagcgggtctg ccgctctcggcgcacaccgacgacccggacgcacggttctcggacgtcgacctcgactct ctggccttcctcgagatgcagaccgctctcgcggagacctacggtgtcgagctgcccgac gaccagacggagcggtacacgttcggcgagatcgtcgacctggtgcaggaccgactggcg gagcgctccgtcgagcgggcccggtga

DBGET integrated database retrieval system