Rathayibacter sp. VKM Ac-2759: GSU68_10365 Help Entry GSU68_10365       CDS       T10520                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rath  Rathayibacter sp. VKM Ac-2759 Pathway rath01100   Metabolic pathways rath01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rath00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GSU68_10365    00074 Mycolic acid biosynthesis     GSU68_10365   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GSU68_10365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QHC66923 LinkDB All DBs Position 2241906..2242154 Genome browser AA seq 82 aa AA seqDB search MALSTEEVLAGLAELVNDETGIATDSVELDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DDEVKNLKTVGDAVTFIVNASA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcactgtccaccgaagaagtcctcgccggcctggccgaactggtcaatgacgagacg ggcatcgcgaccgattccgtcgagctggacaagtcgttcaccgacgacctcgacatcgac tccatctcgatgatgaccatcgtcgtcaacgccgaggagaagttcgacgtcaagatcccg gacgacgaggtcaagaacctcaagacggtcggcgacgcggtcaccttcatcgtcaacgcc tccgcgtag

DBGET integrated database retrieval system