Rhodococcus aetherivorans: AAT18_01415 Help Entry AAT18_01415       CDS       T03876                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism rav  Rhodococcus aetherivorans Pathway rav01100   Metabolic pathways rav01110   Biosynthesis of secondary metabolites Module rav_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:rav00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AAT18_01415    00074 Mycolic acid biosynthesis     AAT18_01415   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AAT18_01415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Vg_Tdu Motif Other DBs NCBI-ProteinID:  AKE88105 UniProt:  A0A0F6VFX9 LinkDB All DBs Position 304214..304465 Genome browser AA seq 83 aa AA seqDB search MTLSYRDIAAVVDEHFPEFSGPIDEHTTFDDLSCDSLVLVELGSILSARYAIDVAEEDMV AAHTFQGVADLVNRLRVDDVATA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgactctctcgtatcgtgacatcgcggccgtcgtcgacgagcactttcccgaattctcc ggccccatcgacgaacacaccaccttcgacgacctcagctgcgactccctggtgctcgtc gagctcgggtcgatcctgtccgcccggtacgcgatcgacgtcgcggaggaggacatggtg gcggcgcacacgttccagggcgtggcggacctggtcaaccgcctgcgggtggacgacgtc gcgacggcgtga

DBGET integrated database retrieval system