Rhizobium anhuiense bv. trifolii: NE851_17535 Help Entry NE851_17535       CDS       T08535                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism raw  Rhizobium anhuiense bv. trifolii Pathway raw01100   Metabolic pathways raw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:raw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NE851_17535    00074 Mycolic acid biosynthesis     NE851_17535   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NE851_17535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  UTS92762 LinkDB All DBs Position 1805848..1806084 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgatcatcttggcgtcgatgcc gacaaggtcgtcgagagcgccagctttatcgacgatctgggcgctgactcgctcgacacg gtcgaacttgtcatggctttcgaagaagaattcggcgttgaaattcctgacgacgctgcc gactcgatcctgacggtcggcgatgccgtgaagtttattgagaaggcccaggcctga

DBGET integrated database retrieval system