KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499847
Entry
107499847         CDS       T06036                                 
Symbol
NRAS
Name
(RefSeq) LOW QUALITY PROTEIN: GTPase NRas
  KO
K07828  GTPase NRas
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04062  Chemokine signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04137  Mitophagy - animal
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04218  Cellular senescence
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04714  Thermogenesis
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray04929  GnRH secretion
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05034  Alcoholism
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05207  Chemical carcinogenesis - receptor activation
ray05208  Chemical carcinogenesis - reactive oxygen species
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107499847 (NRAS)
   04012 ErbB signaling pathway
    107499847 (NRAS)
   04014 Ras signaling pathway
    107499847 (NRAS)
   04015 Rap1 signaling pathway
    107499847 (NRAS)
   04370 VEGF signaling pathway
    107499847 (NRAS)
   04371 Apelin signaling pathway
    107499847 (NRAS)
   04068 FoxO signaling pathway
    107499847 (NRAS)
   04072 Phospholipase D signaling pathway
    107499847 (NRAS)
   04071 Sphingolipid signaling pathway
    107499847 (NRAS)
   04151 PI3K-Akt signaling pathway
    107499847 (NRAS)
   04150 mTOR signaling pathway
    107499847 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107499847 (NRAS)
   04137 Mitophagy - animal
    107499847 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    107499847 (NRAS)
   04218 Cellular senescence
    107499847 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107499847 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    107499847 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107499847 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107499847 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    107499847 (NRAS)
   04660 T cell receptor signaling pathway
    107499847 (NRAS)
   04662 B cell receptor signaling pathway
    107499847 (NRAS)
   04664 Fc epsilon RI signaling pathway
    107499847 (NRAS)
   04062 Chemokine signaling pathway
    107499847 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107499847 (NRAS)
   04929 GnRH secretion
    107499847 (NRAS)
   04912 GnRH signaling pathway
    107499847 (NRAS)
   04915 Estrogen signaling pathway
    107499847 (NRAS)
   04917 Prolactin signaling pathway
    107499847 (NRAS)
   04921 Oxytocin signaling pathway
    107499847 (NRAS)
   04926 Relaxin signaling pathway
    107499847 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    107499847 (NRAS)
   04919 Thyroid hormone signaling pathway
    107499847 (NRAS)
   04916 Melanogenesis
    107499847 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    107499847 (NRAS)
   04726 Serotonergic synapse
    107499847 (NRAS)
   04720 Long-term potentiation
    107499847 (NRAS)
   04730 Long-term depression
    107499847 (NRAS)
   04722 Neurotrophin signaling pathway
    107499847 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    107499847 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    107499847 (NRAS)
   04213 Longevity regulating pathway - multiple species
    107499847 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    107499847 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107499847 (NRAS)
   05206 MicroRNAs in cancer
    107499847 (NRAS)
   05205 Proteoglycans in cancer
    107499847 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    107499847 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    107499847 (NRAS)
   05203 Viral carcinogenesis
    107499847 (NRAS)
   05230 Central carbon metabolism in cancer
    107499847 (NRAS)
   05231 Choline metabolism in cancer
    107499847 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107499847 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107499847 (NRAS)
   05225 Hepatocellular carcinoma
    107499847 (NRAS)
   05226 Gastric cancer
    107499847 (NRAS)
   05214 Glioma
    107499847 (NRAS)
   05216 Thyroid cancer
    107499847 (NRAS)
   05221 Acute myeloid leukemia
    107499847 (NRAS)
   05220 Chronic myeloid leukemia
    107499847 (NRAS)
   05218 Melanoma
    107499847 (NRAS)
   05211 Renal cell carcinoma
    107499847 (NRAS)
   05219 Bladder cancer
    107499847 (NRAS)
   05215 Prostate cancer
    107499847 (NRAS)
   05213 Endometrial cancer
    107499847 (NRAS)
   05224 Breast cancer
    107499847 (NRAS)
   05223 Non-small cell lung cancer
    107499847 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107499847 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    107499847 (NRAS)
   05161 Hepatitis B
    107499847 (NRAS)
   05160 Hepatitis C
    107499847 (NRAS)
   05163 Human cytomegalovirus infection
    107499847 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107499847 (NRAS)
   05165 Human papillomavirus infection
    107499847 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107499847 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    107499847 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    107499847 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107499847 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107499847 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107499847 (NRAS)
   01522 Endocrine resistance
    107499847 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107499847 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107499847 (NRAS)
   04031 GTP-binding proteins [BR:ray04031]
    107499847 (NRAS)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    107499847 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    107499847 (NRAS)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107499847 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   107499847 (NRAS)
  Exosomal proteins of breast cancer cells
   107499847 (NRAS)
  Exosomal proteins of colorectal cancer cells
   107499847 (NRAS)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    107499847 (NRAS)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 107499847
NCBI-ProteinID: XP_015979875
LinkDB
Position
Unknown
AA seq 203 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLITVKVQAPEKSHCQAALTPAL
ILISWRTXSPVSQRRARYCPSSP
NT seq 612 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttggaaaaagcgcgctgacc
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggtgatagacggtgaaacctgtctgttggacatcctggacacggctgga
caggaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggcttcctctgc
gtgtttgccatcaataacagcaagtcatttgcagatattaacctctacagggaacagatt
aagcgagtaaaggactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccgacaaggacagttgacacaaaacaagcccacgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgtggaagatgctttttacacactgata
actgttaaagttcaagcaccagaaaagagccactgtcaagctgcactgacacccgccctg
atcctgatttcctggaggacgnnctccccagtctcacagagacgcgcccgctactgcccc
agctctccgtag

DBGET integrated database retrieval system