Rossellomorea aquimaris: U9J35_02440
Help
Entry
U9J35_02440 CDS
T09670
Symbol
thrC
Name
(GenBank) threonine synthase
KO
K01733
threonine synthase [EC:
4.2.3.1
]
Organism
raz
Rossellomorea aquimaris
Pathway
raz00260
Glycine, serine and threonine metabolism
raz00750
Vitamin B6 metabolism
raz01100
Metabolic pathways
raz01110
Biosynthesis of secondary metabolites
raz01120
Microbial metabolism in diverse environments
raz01230
Biosynthesis of amino acids
Module
raz_M00018
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:
raz00001
]
09100 Metabolism
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
U9J35_02440 (thrC)
09108 Metabolism of cofactors and vitamins
00750 Vitamin B6 metabolism
U9J35_02440 (thrC)
Enzymes [BR:
raz01000
]
4. Lyases
4.2 Carbon-oxygen lyases
4.2.3 Acting on phosphates
4.2.3.1 threonine synthase
U9J35_02440 (thrC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
PALP
ATPgrasp_N
Motif
Other DBs
NCBI-ProteinID:
WRP07046
LinkDB
All DBs
Position
462759..463820
Genome browser
AA seq
353 aa
AA seq
DB search
MRWKGLLEQYGEHLPLNDETPLLTLNEGNTPLVELKTLSREWGIELNVKVEGANPTGSFK
DRGMVLAVAKAVESGSSTVICASTGNTSASAAAYAARAGIKCIVVIPEGKIAQGKLAQAV
MYGAEIISIEGNFDEALEIVRELSKTESVTLVNSVNPYRLEGQKTAAFEVIEGLGEAPDV
LAIPVGNAGNISAYWKGFKEYHNHNASTLPRMFGFEASGAAALVHDRVFPQPETIATAIR
IGNPASWSLAIDALKESNGHIDEVTDDEILEAYQLLASKEGIFAEPASCASIAGIKKSLD
KGLIEKGSKVVAVLTGNGLKDPVTAMECSPVTPVKLPNDREMVKDYIIGTIGV
NT seq
1062 nt
NT seq
+upstream
nt +downstream
nt
atgaggtggaaagggttactggagcagtatggggagcatcttccattaaatgatgagact
cctcttttaacattaaatgaagggaatactcccttggttgaattaaaaacgctgtccagg
gaatggggcatcgagttgaatgtaaaggtagagggagcaaaccctaccggctcctttaaa
gatcgcggaatggttctcgccgttgccaaagcggtagagtcagggagttcgacggtcatt
tgcgcctctaccggaaatacctccgcttcagctgcagcctatgcagcgagggcaggaatc
aagtgtatcgtagtcatccccgagggaaaaattgctcagggaaaactagctcaagctgtc
atgtatggtgccgaaatcatctctatcgaaggaaattttgatgaagccctggaaatcgtc
cgtgagttgagtaaaaccgaatctgtcactcttgtgaattcagtgaatccgtatcgtttg
gaagggcagaaaacagcagcatttgaagtcatcgaaggattgggtgaagcccctgatgtg
ctagcgatccctgtcggtaatgcgggaaatatttcagcatattggaaaggattcaaagaa
taccacaaccacaacgcttcaactttaccacgaatgtttggctttgaagcatctggagca
gcagctctggtccatgacagggtgtttcctcagcctgaaacgattgctactgcgatccga
atcgggaacccggcaagctggtctttagcgattgacgcgttgaaggaatcaaacggacat
attgatgaagtaaccgatgacgaaattcttgaggcctatcagctgcttgcaagtaaagaa
ggaatttttgccgagcccgcttcatgtgcatcgattgcgggaataaagaaatccttagat
aaaggattgatcgagaaaggttcaaaggtagtggcggtgctgacaggtaacggcttaaag
gatccggttacggctatggaatgcagtccggtcacaccggtgaaattgccaaatgatcgt
gaaatggtgaaggactatattatagggacaattggcgtatga
DBGET
integrated database retrieval system