Rouxiella badensis subsp. acadiensis: H2866_14955
Help
Entry
H2866_14955 CDS
T06835
Symbol
uvrY
Name
(GenBank) UvrY/SirA/GacA family response regulator transcription factor
KO
K07689
two-component system, NarL family, invasion response regulator UvrY
Organism
rbad
Rouxiella badensis subsp. acadiensis
Pathway
rbad02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
rbad00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
H2866_14955 (uvrY)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
rbad02022
]
H2866_14955 (uvrY)
Two-component system [BR:
rbad02022
]
NarL family
BarA-UvrY (central carbon metabolism)
H2866_14955 (uvrY)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
GerE
Sigma70_r4_2
HTH_Mga
HTH_29
HTH_23
HTH_7
HTH_24
Sigma70_r4
HTH_40
HTH_28
HTH_5
HTH_26
HTH_11
Terminase_5
HTH_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID:
QOI54251
LinkDB
All DBs
Position
3259718..3260374
Genome browser
AA seq
218 aa
AA seq
DB search
MISVLLVDDHELVRAGIRRILEDIKGIKVVDEMQCGEDAVKWCRSNHVDIVLMDMSMPGI
GGLEATKKIVRFCPDIKIIMLTIYTENPLPAKVMQAGASGYLSKGAAPQEVVNAIRLVDS
GQRYIASDIAQQMALSQLEPQSETPFDTLSERELQIMMMITKGQKVNEISEQLNLSPKTV
NSYRYRMFSKLNINGDVELTHLAIRHGLFNSETLSGSE
NT seq
657 nt
NT seq
+upstream
nt +downstream
nt
ttgattagcgttcttcttgtagatgaccacgaactggtgcgcgcagggattcgacgcatt
cttgaggatatcaaaggcatcaaagttgttgatgagatgcagtgtggtgaagatgccgta
aaatggtgtcgcagtaaccatgtcgatattgtcttgatggatatgagcatgccgggtatt
ggcggccttgaagccacgaagaagattgtgcgcttttgccccgatatcaagataatcatg
ctgactatttatactgaaaaccctttacctgccaaagtgatgcaggcaggtgcttcgggt
tatctcagtaaaggggccgcaccacaggaagtggtcaacgcgattcgcctggtcgattct
ggccagcgctatattgcctccgatattgctcagcaaatggcgctaagccagcttgagcca
cagtcagaaacgccgtttgatacgctgtccgaacgtgagcttcagataatgatgatgatc
accaaagggcaaaaggtgaacgaaatttccgagcagctcaatcttagccccaagacagtc
aacagttatcgttatagaatgtttagtaaactaaatatcaacggtgatgtagaattgacc
catctggcaatccgccacggtcttttcaactcggagacgttatctggtagtgagtaa
DBGET
integrated database retrieval system