Rouxiella badensis subsp. acadiensis: H2866_17565 Help Entry H2866_17565       CDS       T06835                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rbad  Rouxiella badensis subsp. acadiensis Pathway rbad01100   Metabolic pathways rbad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rbad00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H2866_17565    00074 Mycolic acid biosynthesis     H2866_17565   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H2866_17565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ENCP4 Motif Other DBs NCBI-ProteinID:  QOI54718 LinkDB All DBs Position 3818112..3818378 Genome browser AA seq 88 aa AA seqDB search MDQKDILSVVLDTINDIKNTGFTPDVVDLEAFLGGELGVDSVEMLESWYEIEKKLNIKVN DSEKRAIYTLGDLIGKIEAHLPAEAVKS NT seq 267 nt NT seq  +upstreamnt  +downstreamnt gtggatcaaaaagacattctgagcgtggttctcgacacaattaacgatatcaagaacacc ggttttacccctgacgtcgtggatttagaggcatttcttgggggggaattgggcgtggat tccgtcgagatgctcgagtcctggtacgagattgagaagaagctgaacatcaaggttaac gacagcgaaaagcgggcgatttacacgctcggtgacctgattggcaagattgaagcgcat cttcctgccgaagccgtcaaatcctga

DBGET integrated database retrieval system