Rhinopithecus bieti (black snub-nosed monkey): 108514539
Help
Entry
108514539 CDS
T04641
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
rbb
Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03050
Proteasome
rbb05010
Alzheimer disease
rbb05012
Parkinson disease
rbb05014
Amyotrophic lateral sclerosis
rbb05016
Huntington disease
rbb05017
Spinocerebellar ataxia
rbb05020
Prion disease
rbb05022
Pathways of neurodegeneration - multiple diseases
rbb05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
rbb00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
108514539 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
108514539 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
108514539 (PSMD7)
05012 Parkinson disease
108514539 (PSMD7)
05014 Amyotrophic lateral sclerosis
108514539 (PSMD7)
05016 Huntington disease
108514539 (PSMD7)
05017 Spinocerebellar ataxia
108514539 (PSMD7)
05020 Prion disease
108514539 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
108514539 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
rbb03051
]
108514539 (PSMD7)
Proteasome [BR:
rbb03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
108514539 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Coilin_N
Motif
Other DBs
NCBI-GeneID:
108514539
NCBI-ProteinID:
XP_017706304
UniProt:
A0A2K6MXN2
LinkDB
All DBs
Position
Unknown
AA seq
324 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEDSKKDR
KEDKEKDKDKEKSDVKKEEKKEKK
NT seq
975 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtggtggtccaccccctggtgttgctcagtgtggtg
gatcatttcaaccgaatcggcaaggttggaaatcagaagcgcgttgttggtgtgcttttg
gggtcatggcaaaagaaagtacttgatgtatcgaacagttttgcagttccttttgatgaa
gatgacaaagacgattctgtgtggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaagtcaatgccagagaaagaatagttggctggtaccacacaggccctaaa
ctacacaagaatgacattgccatcaacgaactcatgaaaagatactgtcctaattccgta
ttggtcatcattgatgtgaagccgaaggacctagggctgcccacagaagcgtacatttca
gtggaagaagtccatgatgatggaaccccaacctcgaaaacatttgaacacgtgaccagt
gaaattggagcagaggaagctgaggaagttggagttgaacacttgttacgagacatcaaa
gacacgacggtgggcactctgtcccagcggatcacaaaccaggtccatggtttgaaggga
ctgaactccaagcttctggatatcaggagctacctggaaaaagtcgccacaggcaagctg
cctatcaaccaccagatcatctaccagctgcaggatgtcttcaacctgctgccagacgtc
agcctgcaggagtttgtcaaggccttttacctgaagaccaacgaccagatggtggtagtg
tacttggcctcgctgatccgttccgtggtcgccctgcacaacctcatcaacaacaagatt
gccaaccgcgatgcagagaagaaagaagggcaggagaaagaagacagcaaaaaggatagg
aaagaggacaaggagaaagataaagataaggaaaagagtgatgtaaagaaagaggagaaa
aaggagaaaaagtaa
DBGET
integrated database retrieval system