KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108515883
Entry
108515883         CDS       T04641                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1-like isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04145  Phagosome
rbb04148  Efferocytosis
rbb04151  PI3K-Akt signaling pathway
rbb04310  Wnt signaling pathway
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04517  IgSF CAM signaling
rbb04520  Adherens junction
rbb04530  Tight junction
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04670  Leukocyte transendothelial migration
rbb04722  Neurotrophin signaling pathway
rbb04810  Regulation of actin cytoskeleton
rbb04932  Non-alcoholic fatty liver disease
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04972  Pancreatic secretion
rbb05014  Amyotrophic lateral sclerosis
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05100  Bacterial invasion of epithelial cells
rbb05132  Salmonella infection
rbb05135  Yersinia infection
rbb05163  Human cytomegalovirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05208  Chemical carcinogenesis - reactive oxygen species
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05231  Choline metabolism in cancer
rbb05415  Diabetic cardiomyopathy
rbb05416  Viral myocarditis
rbb05417  Lipid and atherosclerosis
rbb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108515883
   04014 Ras signaling pathway
    108515883
   04015 Rap1 signaling pathway
    108515883
   04310 Wnt signaling pathway
    108515883
   04370 VEGF signaling pathway
    108515883
   04071 Sphingolipid signaling pathway
    108515883
   04024 cAMP signaling pathway
    108515883
   04151 PI3K-Akt signaling pathway
    108515883
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    108515883
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108515883
   04148 Efferocytosis
    108515883
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108515883
   04520 Adherens junction
    108515883
   04530 Tight junction
    108515883
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108515883
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108515883
   04620 Toll-like receptor signaling pathway
    108515883
   04650 Natural killer cell mediated cytotoxicity
    108515883
   04662 B cell receptor signaling pathway
    108515883
   04664 Fc epsilon RI signaling pathway
    108515883
   04666 Fc gamma R-mediated phagocytosis
    108515883
   04670 Leukocyte transendothelial migration
    108515883
   04062 Chemokine signaling pathway
    108515883
  09154 Digestive system
   04972 Pancreatic secretion
    108515883
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108515883
  09158 Development and regeneration
   04360 Axon guidance
    108515883
   04380 Osteoclast differentiation
    108515883
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108515883
   05205 Proteoglycans in cancer
    108515883
   05208 Chemical carcinogenesis - reactive oxygen species
    108515883
   05203 Viral carcinogenesis
    108515883
   05231 Choline metabolism in cancer
    108515883
  09162 Cancer: specific types
   05210 Colorectal cancer
    108515883
   05212 Pancreatic cancer
    108515883
   05211 Renal cell carcinoma
    108515883
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108515883
   05163 Human cytomegalovirus infection
    108515883
   05167 Kaposi sarcoma-associated herpesvirus infection
    108515883
   05169 Epstein-Barr virus infection
    108515883
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108515883
   05135 Yersinia infection
    108515883
   05100 Bacterial invasion of epithelial cells
    108515883
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108515883
   05020 Prion disease
    108515883
   05022 Pathways of neurodegeneration - multiple diseases
    108515883
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    108515883
   05418 Fluid shear stress and atherosclerosis
    108515883
   05415 Diabetic cardiomyopathy
    108515883
   05416 Viral myocarditis
    108515883
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108515883
   04933 AGE-RAGE signaling pathway in diabetic complications
    108515883
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108515883
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108515883
   04031 GTP-binding proteins [BR:rbb04031]
    108515883
Membrane trafficking [BR:rbb04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    108515883
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    108515883
  Macropinocytosis
   Ras GTPases
    108515883
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    108515883
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108515883
  Exosomal proteins of other body fluids (saliva and urine)
   108515883
  Exosomal proteins of colorectal cancer cells
   108515883
  Exosomal proteins of bladder cancer cells
   108515883
GTP-binding proteins [BR:rbb04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    108515883
SSDB
Motif
Pfam: Ras Roc NAD_Gly3P_dh_N Arf
Other DBs
NCBI-GeneID: 108515883
NCBI-ProteinID: XP_017708551
LinkDB
Position
Unknown
AA seq 180 aa
MQAIRGVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVTVDGKPVNLGLWDTAA
QEDYDRSCPLSYPQTDLEWQSLKSQEATGAGEDADVFLICFSLVSPASFENVCAKWYPEV
WHHCPNTPIILVGIKLELRDDKDTIEKLKKKLTPITYLQGPAIAKEIGAVKYLECSALTQ
NT seq 543 nt   +upstreamnt  +downstreamnt
atgcaggccatcaggggtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaattat
tctgccaatgttacggtagatggaaaaccagtgaatctgggtttatgggatacagctgct
caagaagattatgacagatcatgccccctatcctatcctcaaacagatttagaatggcaa
tcattaaaaagtcaggaagcaacaggtgctggagaggatgcagatgtgttcttaatttgc
ttttcccttgtgagtcctgcatcatttgaaaatgtctgtgcaaagtggtatcctgaggtg
tggcaccactgtcccaacactcccatcatcctagtgggaattaaacttgaacttagggat
gataaagacacgattgagaaactgaagaagaagctgactcccatcacctatctgcagggt
ccagctatagctaaggagattggtgctgtaaaatacctggagtgctcggcgctcacacag
tga

DBGET integrated database retrieval system