Rhinopithecus bieti (black snub-nosed monkey): 108524569
Help
Entry
108524569 CDS
T04641
Name
(RefSeq) ubiquitin-60S ribosomal protein L40-like
KO
K02927
ubiquitin-large subunit ribosomal protein L40e
Organism
rbb
Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb03010
Ribosome
rbb04120
Ubiquitin mediated proteolysis
rbb04137
Mitophagy - animal
rbb04140
Autophagy - animal
rbb05012
Parkinson disease
rbb05022
Pathways of neurodegeneration - multiple diseases
rbb05167
Kaposi sarcoma-associated herpesvirus infection
rbb05171
Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:
rbb00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
108524569
09123 Folding, sorting and degradation
04120 Ubiquitin mediated proteolysis
108524569
09140 Cellular Processes
09141 Transport and catabolism
04140 Autophagy - animal
108524569
04137 Mitophagy - animal
108524569
09160 Human Diseases
09172 Infectious disease: viral
05171 Coronavirus disease - COVID-19
108524569
05167 Kaposi sarcoma-associated herpesvirus infection
108524569
09164 Neurodegenerative disease
05012 Parkinson disease
108524569
05022 Pathways of neurodegeneration - multiple diseases
108524569
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
rbb03011
]
108524569
04121 Ubiquitin system [BR:
rbb04121
]
108524569
Ribosome [BR:
rbb03011
]
Ribosomal proteins
Eukaryotes
Large subunit
108524569
Archaea
108524569
Ubiquitin system [BR:
rbb04121
]
Ubiquitins and ubiquitin-like proteins
Ubiquitins
108524569
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Ribosomal_L40e
ubiquitin
Rad60-SLD
Motif
Other DBs
NCBI-GeneID:
108524569
NCBI-ProteinID:
XP_017721148
LinkDB
All DBs
Position
Unknown
AA seq
123 aa
AA seq
DB search
MQIFVKTLTGKTITLEVKPSDTNEDVKAKIQDKEDYDIWKQSTLHLMLRLRGGIIEPSLG
QLFQKRNFDKMICRKCYACLHPCAVNCCKKCDHTNNLHPKKKVKALPSSKGSLPGASIKC
LFR
NT seq
372 nt
NT seq
+upstream
nt +downstream
nt
atgcagatctttgtgaagacccttacgggcaagaccatcactcttgaggtcaagcccagt
gacaccaatgaggatgtcaaagccaaaattcaagacaaggaggactacgacatctggaaa
cagtccaccctgcacctgatgctgcgcctgcgaggtggcattatcgagccttccctcggc
cagctcttccagaaacgcaactttgacaagatgatctgccgcaagtgctatgcttgcctg
cacccctgtgctgtcaactgctgcaagaagtgtgaccacaccaacaacctgcaccccaag
aagaaggtcaaggctcttccttcctcgaagggcagcctccctggagcctcaataaagtgt
ctctttcgttga
DBGET
integrated database retrieval system