KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108525752
Entry
108525752         CDS       T04641                                 
Name
(RefSeq) LOW QUALITY PROTEIN: interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04151  PI3K-Akt signaling pathway
rbb04217  Necroptosis
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04622  RIG-I-like receptor signaling pathway
rbb04623  Cytosolic DNA-sensing pathway
rbb04630  JAK-STAT signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04936  Alcoholic liver disease
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05162  Measles
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05168  Herpes simplex virus 1 infection
rbb05169  Epstein-Barr virus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05320  Autoimmune thyroid disease
rbb05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108525752
   04151 PI3K-Akt signaling pathway
    108525752
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108525752
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108525752
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108525752
   04621 NOD-like receptor signaling pathway
    108525752
   04622 RIG-I-like receptor signaling pathway
    108525752
   04623 Cytosolic DNA-sensing pathway
    108525752
   04650 Natural killer cell mediated cytotoxicity
    108525752
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108525752
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108525752
   05161 Hepatitis B
    108525752
   05160 Hepatitis C
    108525752
   05171 Coronavirus disease - COVID-19
    108525752
   05164 Influenza A
    108525752
   05162 Measles
    108525752
   05168 Herpes simplex virus 1 infection
    108525752
   05163 Human cytomegalovirus infection
    108525752
   05167 Kaposi sarcoma-associated herpesvirus infection
    108525752
   05169 Epstein-Barr virus infection
    108525752
   05165 Human papillomavirus infection
    108525752
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108525752
  09163 Immune disease
   05320 Autoimmune thyroid disease
    108525752
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    108525752
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    108525752
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:rbb04052]
    108525752
Cytokines and neuropeptides [BR:rbb04052]
 Cytokines
  Interferons
   108525752
SSDB
Motif
Pfam: Interferon iSTAND
Other DBs
NCBI-GeneID: 108525752
NCBI-ProteinID: XP_017722096
LinkDB
Position
Unknown
AA seq 121 aa
MALSFSLLMAMVVLSYKSICSLGCDLPQTHSLGHRRALILLAQMGRISPFSCLKDRHDFA
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWEQNLLXKFSTELYQQLNDLE
A
NT seq 364 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccatggtggtgctcagctacaaatccatctgc
tctctgggctgtgatctgcctcagacccacagcctgggtcataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgca
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgg
gaacagaatctcctangaaaattttccacggaactttaccagcaactgaatgacctggaa
gcct

DBGET integrated database retrieval system