Rhinopithecus bieti (black snub-nosed monkey): 108527161
Help
Entry
108527161 CDS
T04641
Symbol
ATP5G3
Name
(RefSeq) ATP synthase F(0) complex subunit C3, mitochondrial
KO
K02128
F-type H+-transporting ATPase subunit c
Organism
rbb
Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb00190
Oxidative phosphorylation
rbb01100
Metabolic pathways
rbb04714
Thermogenesis
rbb05010
Alzheimer disease
rbb05012
Parkinson disease
rbb05014
Amyotrophic lateral sclerosis
rbb05016
Huntington disease
rbb05020
Prion disease
rbb05022
Pathways of neurodegeneration - multiple diseases
rbb05208
Chemical carcinogenesis - reactive oxygen species
rbb05415
Diabetic cardiomyopathy
Module
rbb_M00158
F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:
rbb00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
108527161 (ATP5G3)
09150 Organismal Systems
09159 Environmental adaptation
04714 Thermogenesis
108527161 (ATP5G3)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
108527161 (ATP5G3)
09164 Neurodegenerative disease
05010 Alzheimer disease
108527161 (ATP5G3)
05012 Parkinson disease
108527161 (ATP5G3)
05014 Amyotrophic lateral sclerosis
108527161 (ATP5G3)
05016 Huntington disease
108527161 (ATP5G3)
05020 Prion disease
108527161 (ATP5G3)
05022 Pathways of neurodegeneration - multiple diseases
108527161 (ATP5G3)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
108527161 (ATP5G3)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
ATP-synt_C
TM1506
Motif
Other DBs
NCBI-GeneID:
108527161
NCBI-ProteinID:
XP_017723809
UniProt:
A0AAJ7MBI3
LinkDB
All DBs
Position
Unknown
AA seq
141 aa
AA seq
DB search
MFACAKLACTPALIRAGSRVAYRPISASVLSRPEARTGEGSMVFNGAQNGVSQLIQREFQ
TSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGF
ALSEAMGLFCLMVAFLILFAM
NT seq
426 nt
NT seq
+upstream
nt +downstream
nt
atgttcgcctgcgccaagctcgcctgcacgcccgctctgatccgagctggatccagagtt
gcatacagaccaatttctgcatcagtgttatctcgaccagaggctaggactggagagggc
tctatggtatttaatggggcccagaatggtgtgtctcagctaatccaaagggagtttcag
accagtgcaatcagcagagacattgatactgctgccaaatttattggtgcaggtgctgca
acggtaggagtggctggttctggtgctggtattggaacagtctttggcagccttatcatt
ggttatgccagaaacccttcgctgaagcagcagctgttctcatatgctatcctgggattt
gccttgtctgaagctatgggtctcttttgtttgatggttgctttcttgattttgtttgcc
atgtaa
DBGET
integrated database retrieval system