KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108528122
Entry
108528122         CDS       T04641                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04062  Chemokine signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04137  Mitophagy - animal
rbb04140  Autophagy - animal
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04218  Cellular senescence
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04371  Apelin signaling pathway
rbb04540  Gap junction
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04625  C-type lectin receptor signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04714  Thermogenesis
rbb04720  Long-term potentiation
rbb04722  Neurotrophin signaling pathway
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04730  Long-term depression
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04912  GnRH signaling pathway
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04929  GnRH secretion
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04935  Growth hormone synthesis, secretion and action
rbb05010  Alzheimer disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05034  Alcoholism
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05207  Chemical carcinogenesis - receptor activation
rbb05208  Chemical carcinogenesis - reactive oxygen species
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05216  Thyroid cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108528122 (NRAS)
   04012 ErbB signaling pathway
    108528122 (NRAS)
   04014 Ras signaling pathway
    108528122 (NRAS)
   04015 Rap1 signaling pathway
    108528122 (NRAS)
   04370 VEGF signaling pathway
    108528122 (NRAS)
   04371 Apelin signaling pathway
    108528122 (NRAS)
   04068 FoxO signaling pathway
    108528122 (NRAS)
   04072 Phospholipase D signaling pathway
    108528122 (NRAS)
   04071 Sphingolipid signaling pathway
    108528122 (NRAS)
   04151 PI3K-Akt signaling pathway
    108528122 (NRAS)
   04150 mTOR signaling pathway
    108528122 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108528122 (NRAS)
   04137 Mitophagy - animal
    108528122 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    108528122 (NRAS)
   04218 Cellular senescence
    108528122 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108528122 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    108528122 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108528122 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108528122 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    108528122 (NRAS)
   04660 T cell receptor signaling pathway
    108528122 (NRAS)
   04662 B cell receptor signaling pathway
    108528122 (NRAS)
   04664 Fc epsilon RI signaling pathway
    108528122 (NRAS)
   04062 Chemokine signaling pathway
    108528122 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108528122 (NRAS)
   04929 GnRH secretion
    108528122 (NRAS)
   04912 GnRH signaling pathway
    108528122 (NRAS)
   04915 Estrogen signaling pathway
    108528122 (NRAS)
   04917 Prolactin signaling pathway
    108528122 (NRAS)
   04921 Oxytocin signaling pathway
    108528122 (NRAS)
   04926 Relaxin signaling pathway
    108528122 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    108528122 (NRAS)
   04919 Thyroid hormone signaling pathway
    108528122 (NRAS)
   04916 Melanogenesis
    108528122 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    108528122 (NRAS)
   04726 Serotonergic synapse
    108528122 (NRAS)
   04720 Long-term potentiation
    108528122 (NRAS)
   04730 Long-term depression
    108528122 (NRAS)
   04722 Neurotrophin signaling pathway
    108528122 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    108528122 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    108528122 (NRAS)
   04213 Longevity regulating pathway - multiple species
    108528122 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    108528122 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108528122 (NRAS)
   05206 MicroRNAs in cancer
    108528122 (NRAS)
   05205 Proteoglycans in cancer
    108528122 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    108528122 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    108528122 (NRAS)
   05203 Viral carcinogenesis
    108528122 (NRAS)
   05230 Central carbon metabolism in cancer
    108528122 (NRAS)
   05231 Choline metabolism in cancer
    108528122 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108528122 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108528122 (NRAS)
   05225 Hepatocellular carcinoma
    108528122 (NRAS)
   05226 Gastric cancer
    108528122 (NRAS)
   05214 Glioma
    108528122 (NRAS)
   05216 Thyroid cancer
    108528122 (NRAS)
   05221 Acute myeloid leukemia
    108528122 (NRAS)
   05220 Chronic myeloid leukemia
    108528122 (NRAS)
   05218 Melanoma
    108528122 (NRAS)
   05211 Renal cell carcinoma
    108528122 (NRAS)
   05219 Bladder cancer
    108528122 (NRAS)
   05215 Prostate cancer
    108528122 (NRAS)
   05213 Endometrial cancer
    108528122 (NRAS)
   05224 Breast cancer
    108528122 (NRAS)
   05223 Non-small cell lung cancer
    108528122 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108528122 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    108528122 (NRAS)
   05161 Hepatitis B
    108528122 (NRAS)
   05160 Hepatitis C
    108528122 (NRAS)
   05163 Human cytomegalovirus infection
    108528122 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108528122 (NRAS)
   05165 Human papillomavirus infection
    108528122 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108528122 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    108528122 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    108528122 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    108528122 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108528122 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108528122 (NRAS)
   01522 Endocrine resistance
    108528122 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rbb04131]
    108528122 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108528122 (NRAS)
   04031 GTP-binding proteins [BR:rbb04031]
    108528122 (NRAS)
Membrane trafficking [BR:rbb04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    108528122 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    108528122 (NRAS)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108528122 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   108528122 (NRAS)
  Exosomal proteins of breast cancer cells
   108528122 (NRAS)
  Exosomal proteins of colorectal cancer cells
   108528122 (NRAS)
GTP-binding proteins [BR:rbb04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    108528122 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 108528122
NCBI-ProteinID: XP_017725275
UniProt: A0A2K6MUC7
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
agaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctgga
caagaagagtacagtgccatgagagatcaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt
aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacaaggacagttgatacaaagcaagcccacgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt
tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system