KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108536070
Entry
108536070         CDS       T04641                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01521  EGFR tyrosine kinase inhibitor resistance
rbb01522  Endocrine resistance
rbb01524  Platinum drug resistance
rbb04010  MAPK signaling pathway
rbb04012  ErbB signaling pathway
rbb04014  Ras signaling pathway
rbb04015  Rap1 signaling pathway
rbb04022  cGMP-PKG signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04066  HIF-1 signaling pathway
rbb04068  FoxO signaling pathway
rbb04071  Sphingolipid signaling pathway
rbb04072  Phospholipase D signaling pathway
rbb04114  Oocyte meiosis
rbb04140  Autophagy - animal
rbb04148  Efferocytosis
rbb04150  mTOR signaling pathway
rbb04151  PI3K-Akt signaling pathway
rbb04210  Apoptosis
rbb04218  Cellular senescence
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04270  Vascular smooth muscle contraction
rbb04350  TGF-beta signaling pathway
rbb04360  Axon guidance
rbb04370  VEGF signaling pathway
rbb04371  Apelin signaling pathway
rbb04380  Osteoclast differentiation
rbb04510  Focal adhesion
rbb04520  Adherens junction
rbb04540  Gap junction
rbb04550  Signaling pathways regulating pluripotency of stem cells
rbb04611  Platelet activation
rbb04613  Neutrophil extracellular trap formation
rbb04620  Toll-like receptor signaling pathway
rbb04621  NOD-like receptor signaling pathway
rbb04625  C-type lectin receptor signaling pathway
rbb04650  Natural killer cell mediated cytotoxicity
rbb04657  IL-17 signaling pathway
rbb04658  Th1 and Th2 cell differentiation
rbb04659  Th17 cell differentiation
rbb04660  T cell receptor signaling pathway
rbb04662  B cell receptor signaling pathway
rbb04664  Fc epsilon RI signaling pathway
rbb04666  Fc gamma R-mediated phagocytosis
rbb04668  TNF signaling pathway
rbb04713  Circadian entrainment
rbb04720  Long-term potentiation
rbb04722  Neurotrophin signaling pathway
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04730  Long-term depression
rbb04810  Regulation of actin cytoskeleton
rbb04910  Insulin signaling pathway
rbb04912  GnRH signaling pathway
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04917  Prolactin signaling pathway
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04926  Relaxin signaling pathway
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04929  GnRH secretion
rbb04930  Type II diabetes mellitus
rbb04933  AGE-RAGE signaling pathway in diabetic complications
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb04960  Aldosterone-regulated sodium reabsorption
rbb05010  Alzheimer disease
rbb05020  Prion disease
rbb05022  Pathways of neurodegeneration - multiple diseases
rbb05034  Alcoholism
rbb05132  Salmonella infection
rbb05133  Pertussis
rbb05135  Yersinia infection
rbb05140  Leishmaniasis
rbb05142  Chagas disease
rbb05145  Toxoplasmosis
rbb05152  Tuberculosis
rbb05160  Hepatitis C
rbb05161  Hepatitis B
rbb05163  Human cytomegalovirus infection
rbb05164  Influenza A
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05167  Kaposi sarcoma-associated herpesvirus infection
rbb05170  Human immunodeficiency virus 1 infection
rbb05171  Coronavirus disease - COVID-19
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05206  MicroRNAs in cancer
rbb05207  Chemical carcinogenesis - receptor activation
rbb05208  Chemical carcinogenesis - reactive oxygen species
rbb05210  Colorectal cancer
rbb05211  Renal cell carcinoma
rbb05212  Pancreatic cancer
rbb05213  Endometrial cancer
rbb05214  Glioma
rbb05215  Prostate cancer
rbb05216  Thyroid cancer
rbb05218  Melanoma
rbb05219  Bladder cancer
rbb05220  Chronic myeloid leukemia
rbb05221  Acute myeloid leukemia
rbb05223  Non-small cell lung cancer
rbb05224  Breast cancer
rbb05225  Hepatocellular carcinoma
rbb05226  Gastric cancer
rbb05230  Central carbon metabolism in cancer
rbb05231  Choline metabolism in cancer
rbb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rbb05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108536070 (MAPK1)
   04012 ErbB signaling pathway
    108536070 (MAPK1)
   04014 Ras signaling pathway
    108536070 (MAPK1)
   04015 Rap1 signaling pathway
    108536070 (MAPK1)
   04350 TGF-beta signaling pathway
    108536070 (MAPK1)
   04370 VEGF signaling pathway
    108536070 (MAPK1)
   04371 Apelin signaling pathway
    108536070 (MAPK1)
   04668 TNF signaling pathway
    108536070 (MAPK1)
   04066 HIF-1 signaling pathway
    108536070 (MAPK1)
   04068 FoxO signaling pathway
    108536070 (MAPK1)
   04072 Phospholipase D signaling pathway
    108536070 (MAPK1)
   04071 Sphingolipid signaling pathway
    108536070 (MAPK1)
   04024 cAMP signaling pathway
    108536070 (MAPK1)
   04022 cGMP-PKG signaling pathway
    108536070 (MAPK1)
   04151 PI3K-Akt signaling pathway
    108536070 (MAPK1)
   04150 mTOR signaling pathway
    108536070 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108536070 (MAPK1)
   04148 Efferocytosis
    108536070 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    108536070 (MAPK1)
   04210 Apoptosis
    108536070 (MAPK1)
   04218 Cellular senescence
    108536070 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108536070 (MAPK1)
   04520 Adherens junction
    108536070 (MAPK1)
   04540 Gap junction
    108536070 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    108536070 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108536070 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108536070 (MAPK1)
   04613 Neutrophil extracellular trap formation
    108536070 (MAPK1)
   04620 Toll-like receptor signaling pathway
    108536070 (MAPK1)
   04621 NOD-like receptor signaling pathway
    108536070 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    108536070 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    108536070 (MAPK1)
   04660 T cell receptor signaling pathway
    108536070 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    108536070 (MAPK1)
   04659 Th17 cell differentiation
    108536070 (MAPK1)
   04657 IL-17 signaling pathway
    108536070 (MAPK1)
   04662 B cell receptor signaling pathway
    108536070 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    108536070 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    108536070 (MAPK1)
   04062 Chemokine signaling pathway
    108536070 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108536070 (MAPK1)
   04929 GnRH secretion
    108536070 (MAPK1)
   04912 GnRH signaling pathway
    108536070 (MAPK1)
   04915 Estrogen signaling pathway
    108536070 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    108536070 (MAPK1)
   04917 Prolactin signaling pathway
    108536070 (MAPK1)
   04921 Oxytocin signaling pathway
    108536070 (MAPK1)
   04926 Relaxin signaling pathway
    108536070 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    108536070 (MAPK1)
   04919 Thyroid hormone signaling pathway
    108536070 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    108536070 (MAPK1)
   04916 Melanogenesis
    108536070 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108536070 (MAPK1)
   04270 Vascular smooth muscle contraction
    108536070 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108536070 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    108536070 (MAPK1)
   04725 Cholinergic synapse
    108536070 (MAPK1)
   04726 Serotonergic synapse
    108536070 (MAPK1)
   04720 Long-term potentiation
    108536070 (MAPK1)
   04730 Long-term depression
    108536070 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    108536070 (MAPK1)
   04722 Neurotrophin signaling pathway
    108536070 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    108536070 (MAPK1)
   04380 Osteoclast differentiation
    108536070 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108536070 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108536070 (MAPK1)
   05206 MicroRNAs in cancer
    108536070 (MAPK1)
   05205 Proteoglycans in cancer
    108536070 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    108536070 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    108536070 (MAPK1)
   05203 Viral carcinogenesis
    108536070 (MAPK1)
   05230 Central carbon metabolism in cancer
    108536070 (MAPK1)
   05231 Choline metabolism in cancer
    108536070 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108536070 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108536070 (MAPK1)
   05212 Pancreatic cancer
    108536070 (MAPK1)
   05225 Hepatocellular carcinoma
    108536070 (MAPK1)
   05226 Gastric cancer
    108536070 (MAPK1)
   05214 Glioma
    108536070 (MAPK1)
   05216 Thyroid cancer
    108536070 (MAPK1)
   05221 Acute myeloid leukemia
    108536070 (MAPK1)
   05220 Chronic myeloid leukemia
    108536070 (MAPK1)
   05218 Melanoma
    108536070 (MAPK1)
   05211 Renal cell carcinoma
    108536070 (MAPK1)
   05219 Bladder cancer
    108536070 (MAPK1)
   05215 Prostate cancer
    108536070 (MAPK1)
   05213 Endometrial cancer
    108536070 (MAPK1)
   05224 Breast cancer
    108536070 (MAPK1)
   05223 Non-small cell lung cancer
    108536070 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108536070 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    108536070 (MAPK1)
   05161 Hepatitis B
    108536070 (MAPK1)
   05160 Hepatitis C
    108536070 (MAPK1)
   05171 Coronavirus disease - COVID-19
    108536070 (MAPK1)
   05164 Influenza A
    108536070 (MAPK1)
   05163 Human cytomegalovirus infection
    108536070 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108536070 (MAPK1)
   05165 Human papillomavirus infection
    108536070 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108536070 (MAPK1)
   05135 Yersinia infection
    108536070 (MAPK1)
   05133 Pertussis
    108536070 (MAPK1)
   05152 Tuberculosis
    108536070 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108536070 (MAPK1)
   05140 Leishmaniasis
    108536070 (MAPK1)
   05142 Chagas disease
    108536070 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108536070 (MAPK1)
   05020 Prion disease
    108536070 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    108536070 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    108536070 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    108536070 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108536070 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108536070 (MAPK1)
   04934 Cushing syndrome
    108536070 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108536070 (MAPK1)
   01524 Platinum drug resistance
    108536070 (MAPK1)
   01522 Endocrine resistance
    108536070 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108536070 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rbb03036]
    108536070 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbb04147]
    108536070 (MAPK1)
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108536070 (MAPK1)
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108536070 (MAPK1)
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     108536070 (MAPK1)
Exosome [BR:rbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108536070 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH RIO1 STATB_N Haspin_kinase FTA2 Kdo Kinase-like
Other DBs
NCBI-GeneID: 108536070
NCBI-ProteinID: XP_017738034
LinkDB
Position
Unknown
AA seq 323 aa
MVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQ
MKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLL
NTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNR
LFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDD
LPKEKLKELIFEETARFQPGYRS
NT seq 972 nt   +upstreamnt  +downstreamnt
atggtgtgctctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagc
ccctttgagcaccagacctactgccagagaaccctgcgggagataaaaatcttactgcgc
ttcagacatgagaacatcattggaatcaatgacattattcgagcaccaaccatcgagcaa
atgaaagatgtatacatagtacaagacctcatggaaacagatctttacaagctcttgaag
acacaacacctcagcaacgaccatatctgctattttctttaccagatcctcagagggtta
aaatatatccattcagctaacgttctgcaccgtgacctcaagccttccaacctgctgctc
aacaccacctgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagac
catgatcacacagggttcctgacagaatatgtggccacacgttggtacagggctccagaa
attatgttgaattccaagggctacaccaagtccattgatatttggtctgtaggctgcatt
ctggcagaaatgctttctaacaggcccatctttccagggaagcattatcttgaccagctg
aaccacattctgggtattcttggatccccatcacaagaagacctgaattgtataataaat
ttaaaagctaggaactatttgctttctcttccacacaaaaataaggtgccatggaacagg
ctgttcccaaatgctgactccaaagctctggacttactggacaaaatgttgacattcaac
cctcataagaggattgaagtagaacaggctctggcccacccatatctggagcagtattac
gacccgagtgacgagcccattgctgaagcaccattcaagttcgacatggaattggatgac
ttgcctaaggaaaagctcaaagaactaatttttgaagagactgctagattccagccagga
tacagatcttaa

DBGET integrated database retrieval system