KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108540003
Entry
108540003         CDS       T04641                                 
Name
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb01522  Endocrine resistance
rbb04010  MAPK signaling pathway
rbb04014  Ras signaling pathway
rbb04020  Calcium signaling pathway
rbb04024  cAMP signaling pathway
rbb04062  Chemokine signaling pathway
rbb04081  Hormone signaling
rbb04082  Neuroactive ligand signaling
rbb04114  Oocyte meiosis
rbb04140  Autophagy - animal
rbb04211  Longevity regulating pathway
rbb04213  Longevity regulating pathway - multiple species
rbb04261  Adrenergic signaling in cardiomyocytes
rbb04270  Vascular smooth muscle contraction
rbb04310  Wnt signaling pathway
rbb04340  Hedgehog signaling pathway
rbb04371  Apelin signaling pathway
rbb04530  Tight junction
rbb04540  Gap junction
rbb04611  Platelet activation
rbb04713  Circadian entrainment
rbb04714  Thermogenesis
rbb04720  Long-term potentiation
rbb04723  Retrograde endocannabinoid signaling
rbb04724  Glutamatergic synapse
rbb04725  Cholinergic synapse
rbb04726  Serotonergic synapse
rbb04727  GABAergic synapse
rbb04728  Dopaminergic synapse
rbb04740  Olfactory transduction
rbb04742  Taste transduction
rbb04750  Inflammatory mediator regulation of TRP channels
rbb04910  Insulin signaling pathway
rbb04911  Insulin secretion
rbb04912  GnRH signaling pathway
rbb04913  Ovarian steroidogenesis
rbb04914  Progesterone-mediated oocyte maturation
rbb04915  Estrogen signaling pathway
rbb04916  Melanogenesis
rbb04918  Thyroid hormone synthesis
rbb04919  Thyroid hormone signaling pathway
rbb04921  Oxytocin signaling pathway
rbb04922  Glucagon signaling pathway
rbb04923  Regulation of lipolysis in adipocytes
rbb04924  Renin secretion
rbb04925  Aldosterone synthesis and secretion
rbb04926  Relaxin signaling pathway
rbb04927  Cortisol synthesis and secretion
rbb04928  Parathyroid hormone synthesis, secretion and action
rbb04934  Cushing syndrome
rbb04935  Growth hormone synthesis, secretion and action
rbb04961  Endocrine and other factor-regulated calcium reabsorption
rbb04962  Vasopressin-regulated water reabsorption
rbb04970  Salivary secretion
rbb04971  Gastric acid secretion
rbb04976  Bile secretion
rbb05012  Parkinson disease
rbb05020  Prion disease
rbb05030  Cocaine addiction
rbb05031  Amphetamine addiction
rbb05032  Morphine addiction
rbb05034  Alcoholism
rbb05146  Amoebiasis
rbb05163  Human cytomegalovirus infection
rbb05165  Human papillomavirus infection
rbb05166  Human T-cell leukemia virus 1 infection
rbb05200  Pathways in cancer
rbb05203  Viral carcinogenesis
rbb05205  Proteoglycans in cancer
rbb05207  Chemical carcinogenesis - receptor activation
rbb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108540003
   04310 Wnt signaling pathway
    108540003
   04024 cAMP signaling pathway
    108540003
  09133 Signaling molecules and interaction
   04082 Neuroactive ligand signaling
    108540003
   04081 Hormone signaling
    108540003
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108540003
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108540003
   04062 Chemokine signaling pathway
    108540003
  09152 Endocrine system
   04911 Insulin secretion
    108540003
   04922 Glucagon signaling pathway
    108540003
   04923 Regulation of lipolysis in adipocytes
    108540003
   04913 Ovarian steroidogenesis
    108540003
   04915 Estrogen signaling pathway
    108540003
   04921 Oxytocin signaling pathway
    108540003
   04926 Relaxin signaling pathway
    108540003
   04935 Growth hormone synthesis, secretion and action
    108540003
   04918 Thyroid hormone synthesis
    108540003
   04919 Thyroid hormone signaling pathway
    108540003
   04928 Parathyroid hormone synthesis, secretion and action
    108540003
   04924 Renin secretion
    108540003
   04925 Aldosterone synthesis and secretion
    108540003
   04927 Cortisol synthesis and secretion
    108540003
  09154 Digestive system
   04970 Salivary secretion
    108540003
   04971 Gastric acid secretion
    108540003
   04976 Bile secretion
    108540003
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    108540003
   04961 Endocrine and other factor-regulated calcium reabsorption
    108540003
  09156 Nervous system
   04724 Glutamatergic synapse
    108540003
   04727 GABAergic synapse
    108540003
   04725 Cholinergic synapse
    108540003
   04728 Dopaminergic synapse
    108540003
   04726 Serotonergic synapse
    108540003
   04720 Long-term potentiation
    108540003
   04723 Retrograde endocannabinoid signaling
    108540003
  09157 Sensory system
   04740 Olfactory transduction
    108540003
   04742 Taste transduction
    108540003
   04750 Inflammatory mediator regulation of TRP channels
    108540003
  09149 Aging
   04211 Longevity regulating pathway
    108540003
   04213 Longevity regulating pathway - multiple species
    108540003
  09159 Environmental adaptation
   04713 Circadian entrainment
    108540003
   04714 Thermogenesis
    108540003
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108540003
   05205 Proteoglycans in cancer
    108540003
   05207 Chemical carcinogenesis - receptor activation
    108540003
   05203 Viral carcinogenesis
    108540003
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108540003
   05163 Human cytomegalovirus infection
    108540003
   05165 Human papillomavirus infection
    108540003
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108540003
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108540003
   05020 Prion disease
    108540003
  09165 Substance dependence
   05030 Cocaine addiction
    108540003
   05031 Amphetamine addiction
    108540003
   05032 Morphine addiction
    108540003
   05034 Alcoholism
    108540003
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    108540003
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108540003
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108540003
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rbb01001]
    108540003
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rbb03019]
    108540003
   03036 Chromosome and associated proteins [BR:rbb03036]
    108540003
Enzymes [BR:rbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     108540003
Protein kinases [BR:rbb01001]
 Serine/threonine kinases: AGC group
  PKA family
   108540003
Messenger RNA biogenesis [BR:rbb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     108540003
Chromosome and associated proteins [BR:rbb03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    108540003
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1
Other DBs
NCBI-GeneID: 108540003
NCBI-ProteinID: XP_017744474
UniProt: A0AAJ7IC42
LinkDB
Position
Unknown
AA seq 183 aa
LDWRCLPLGKALQGHLLDHFGAWPLTFTSPFVPISEPHARFYAAQIVLTFEYLHSLDLIY
RDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWAL
GVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRSGCGDTVLEETDPSLLTRPTPWGALLVV
RII
NT seq 552 nt   +upstreamnt  +downstreamnt
ctggactggaggtgtcttcctctggggaaggctctgcagggccacctgctggaccatttt
ggggcatggccactgacattcacctctccatttgtccccatcagcgagccccatgcccgt
ttctacgcggcccagatcgttctgaccttcgagtatctgcactcgctggatctcatctac
agggacctgaagccggagaatctgctcattgaccagcagggatacattcaggtgacagac
ttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgcggcacccctgagtat
ctggcccctgagattatcctgagcaaaggctacaacaaggccgtggactggtgggccctg
ggggttcttatctatgaaatggccgctggctacccgcccttcttcgcagaccagcccatc
cagatctatgagaagatcgtctctgggaaggtgaggtccggctgcggggacacagtcctg
gaagaaacagacccttccctgctcacccgtcctactccctggggagccctgcttgttgtc
agaataatctag

DBGET integrated database retrieval system