Rhinopithecus bieti (black snub-nosed monkey): 108542677
Help
Entry
108542677 CDS
T04641
Symbol
VEGFB
Name
(RefSeq) vascular endothelial growth factor B isoform X1
KO
K16858
vascular endothelial growth factor B
Organism
rbb
Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04010
MAPK signaling pathway
rbb04014
Ras signaling pathway
rbb04015
Rap1 signaling pathway
rbb04020
Calcium signaling pathway
rbb04151
PI3K-Akt signaling pathway
rbb04510
Focal adhesion
rbb04926
Relaxin signaling pathway
rbb04933
AGE-RAGE signaling pathway in diabetic complications
rbb05200
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:
rbb00001
]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
108542677 (VEGFB)
04014 Ras signaling pathway
108542677 (VEGFB)
04015 Rap1 signaling pathway
108542677 (VEGFB)
04020 Calcium signaling pathway
108542677 (VEGFB)
04151 PI3K-Akt signaling pathway
108542677 (VEGFB)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04510 Focal adhesion
108542677 (VEGFB)
09150 Organismal Systems
09152 Endocrine system
04926 Relaxin signaling pathway
108542677 (VEGFB)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
108542677 (VEGFB)
09167 Endocrine and metabolic disease
04933 AGE-RAGE signaling pathway in diabetic complications
108542677 (VEGFB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
rbb04052
]
108542677 (VEGFB)
Cytokines and neuropeptides [BR:
rbb04052
]
Cytokines
Growth factors (RTK binding)
108542677 (VEGFB)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
PDGF
Motif
Other DBs
NCBI-GeneID:
108542677
NCBI-ProteinID:
XP_017748270
LinkDB
All DBs
Position
Unknown
AA seq
116 aa
AA seq
DB search
MGSNQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSALKPDRAATPHHRPQPRSVP
GWDSAPGAPSPADITHPTPAPGPSAHAAPSATSALTPGPAAAAVDAAASSVAKGGA
NT seq
351 nt
NT seq
+upstream
nt +downstream
nt
atgggcagcaaccaagtccggatgcagatcctcatgatccggtacccgagcagtcagctg
ggggagatgtccctggaagaacacagccagtgtgaatgcagacctaaaaaaaaggacagt
gctctgaagccggacagggctgccactccccaccaccgtccccagccccgctctgttccg
ggctgggactctgcccccggagcaccctccccagctgacatcacccatcccactccagcc
ccaggaccctctgcccacgctgcacccagcgccaccagcgccctgacccccggacctgcc
gctgccgctgtcgacgccgcagcttcctccgttgccaagggcggggcttag
DBGET
integrated database retrieval system