Mucinivorans hirudinis: BN938_2132
Help
Entry
BN938_2132 CDS
T03205
Name
(GenBank) Electron transport complex protein RnfB
KO
K03616
H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:
7.1.1.11
7.2.1.2
]
Organism
rbc
Mucinivorans hirudinis
Brite
KEGG Orthology (KO) [BR:
rbc00001
]
09190 Not Included in Pathway or Brite
09191 Unclassified: metabolism
99980 Enzymes with EC numbers
BN938_2132
Enzymes [BR:
rbc01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.11 ferredoxin---NAD+ oxidoreductase (H+-transporting)
BN938_2132
7.2 Catalysing the translocation of inorganic cations
7.2.1 Linked to oxidoreductase reactions
7.2.1.2 ferredoxin---NAD+ oxidoreductase (Na+-transporting)
BN938_2132
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Fer4_6
Fer4
Fer4_7
FeS
Fer4_9
Fer4_21
Fer4_2
Fer4_16
Fer4_10
Fer4_4
Fer4_15
PALP
Fer4_3
Fer4_8
Fer4_13
Fer4_17
Motif
Other DBs
NCBI-ProteinID:
CDN32205
UniProt:
A0A060R9C0
LinkDB
All DBs
Position
complement(2177367..2178227)
Genome browser
AA seq
286 aa
AA seq
DB search
MNEALLFTIIVLVGLGVVAAVILYFVAQKFKVYEDPRIDQSEALLPGANCGGCGFPGCRG
FATALVEQEDISALFCPVGGGDTMRAVAALLGKAAPEKEPAVAVVRCAGSYCNRARTNEF
VGADSCAVVASLYGGETGCTWGCLGKGDCVVVCRFDAIFINPETGLPEVDQEKCTACGAC
VAACPKAIIELRKRGVKGRRIFVSCVNRDKGAVARKACGVACIGCGKCVKSCAFEAITLE
NNLAYINPEKCKLCRKCGVECPTGAIWEVNFPPRKEQVVQGLSDEK
NT seq
861 nt
NT seq
+upstream
nt +downstream
nt
atgaacgaagcactgctattcacaattatagtactggtagggttaggcgtggttgcagcc
gtgatactatactttgtagctcagaaatttaaggtatatgaagaccctcgtatagaccaa
agtgaggcgttgcttccgggtgcaaactgcgggggatgcggatttccggggtgtcgcggg
tttgctacggcattggtcgagcaggaggatatctcggcactattttgccccgtaggcggt
ggcgatacgatgagggcggttgcagcactgctgggaaaagctgcgcccgagaaagagcct
gccgttgctgtggtcaggtgtgcgggaagttattgcaaccgtgcgcgaacaaacgaattt
gtgggtgctgactcgtgtgcggtggttgcctcgctctatggcggggagacgggttgcacg
tggggttgtttgggtaagggcgactgtgtggtggtttgtcggttcgacgcgattttcatt
aaccccgaaacaggtttgcccgaggtagaccaagagaagtgtacggcgtgtggggcgtgt
gtggcggcgtgtccaaaggcgattattgagttgcgaaagaggggggtgaagggtcgtcgg
atttttgtgtcgtgtgtaaatcgggacaagggtgctgtggcgcgcaaggcttgtggggtg
gcttgcattggttgcggtaaatgtgtgaagagttgcgctttcgaggcaataacactggag
aataacttggcatatatcaatcccgaaaagtgtaaattatgcagaaaatgtggagtcgag
tgcccaacgggggcgatttgggaggtgaatttcccgccacgcaaagaacaggttgtgcaa
ggattaagcgacgaaaaataa
DBGET
integrated database retrieval system