Aerosticca soli: ALSL_1358 Help Entry ALSL_1358         CDS       T06043                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism rbd  Aerosticca soli Brite KEGG Orthology (KO) [BR:rbd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rbd03110]     ALSL_1358 Chaperones and folding catalysts [BR:rbd03110]  Protein folding catalysts   Protein disulfide isomerase    ALSL_1358 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 SH3BGR GST_N_2 Glrx-like Thioredoxin_3 GST_N Thioredoxin_2 DSBA Motif Other DBs NCBI-ProteinID:  BBD80015 UniProt:  A0A2Z6E4H8 LinkDB All DBs Position 1439744..1440007 Genome browser AA seq 87 aa AA seqDB search MPRIEIFSTATCPYCTAAKNLLKAKGLSWEEVRIDTDPAQRERMLERSGGRRTVPQIFIN DQHVGGYDDLVAADRSGKLKTLLESAT NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgccccgcatcgagattttttccaccgccacctgtccctactgcaccgccgccaagaat ctcctgaaggccaaggggctgagctgggaggaggtgcgcatcgacaccgatccggcccag cgcgagcgcatgctcgagcgcagcggcggccgccgcaccgtgccgcagatcttcatcaac gaccagcacgtcggcggttatgacgacctcgtcgccgccgatcgcagcggcaaactcaag accttgctggagagcgcgacatga

DBGET integrated database retrieval system