Aerosticca soli: ALSL_2340 Help Entry ALSL_2340         CDS       T06043                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism rbd  Aerosticca soli Brite KEGG Orthology (KO) [BR:rbd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rbd03036]     ALSL_2340 Chromosome and associated proteins [BR:rbd03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     ALSL_2340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  BBD80965 UniProt:  A0A2Z6E714 LinkDB All DBs Position complement(2494982..2495254) Genome browser AA seq 90 aa AA seqDB search MRALGTLALVALLAAVLGSALAVVWTRHESRALFITLTTLQNQRDELNIEFGRLELEQAT WAEPRRIDEEARGKLGMLMPRPQDVVLVHR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagggcgctgggcacgctggccctggtcgcgctgctcgcggccgtgctcggcagcgcg ctcgccgtggtctggacgcgccacgagagccgtgcgctgttcatcaccctgaccacgctg cagaaccagcgcgacgagctcaacatcgaattcggccggctggaactcgaacaggcgacc tgggccgagccgcggcggatcgacgaggaggcgcgcggcaagctcggcatgctcatgccg cgtccgcaggacgtcgtgctggtgcaccgatga

DBGET integrated database retrieval system