Rhodocyclaceae bacterium Thauera-like: B4966_01260 Help Entry B4966_01260       CDS       T05394                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism rbh  Rhodocyclaceae bacterium Thauera-like Brite KEGG Orthology (KO) [BR:rbh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rbh03032]     B4966_01260    03036 Chromosome and associated proteins [BR:rbh03036]     B4966_01260    03400 DNA repair and recombination proteins [BR:rbh03400]     B4966_01260 DNA replication proteins [BR:rbh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     B4966_01260 Chromosome and associated proteins [BR:rbh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     B4966_01260 DNA repair and recombination proteins [BR:rbh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       B4966_01260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 DUF2267 HU-CCDC81_bac_2 HU-CCDC81_euk_1 UBA_HYPK HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  AUL98953 UniProt:  A0A2K9L723 LinkDB All DBs Position 278203..278481 Genome browser AA seq 92 aa AA seqDB search MNKGEFVEALADRLDVSRAQADRALSGVLDLIAEQLAKGEKVAFTGFGSFEVSKRAERTG RNPQTGATIKIAASSVPKFTAGATLKAAVNGK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaggtgaattcgtcgaagccttggccgaccgcctggatgtttcccgcgctcaa gccgaccgcgccctgtcgggcgtgctcgacctcatcgctgagcaactggccaagggcgaa aaggtggcctttaccggttttggctccttcgaggtttccaaacgcgccgagcgcaccggt cgcaatccgcagaccggcgccaccatcaagattgccgcctccagcgtgcccaaattcacc gctggtgcaaccttgaaagcggcggtcaacggcaagtaa

DBGET integrated database retrieval system