KEGG   Rhodocyclaceae bacterium Thauera-like: B4966_02825
Entry
B4966_02825       CDS       T05394                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
rbh  Rhodocyclaceae bacterium Thauera-like
Pathway
rbh00770  Pantothenate and CoA biosynthesis
rbh01100  Metabolic pathways
rbh01240  Biosynthesis of cofactors
Module
rbh_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:rbh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    B4966_02825
Enzymes [BR:rbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     B4966_02825
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AUL99233
LinkDB
Position
complement(596496..596990)
AA seq 164 aa
MRHGKVVYPGTFDPMTRGHEDIVRRAAMLFDQVIVGVAQSAGKAPIFTMEERVEMAREIL
APFPNVTVIGFDGLLMNFLRAQDARLILRGLRAVSDFEYEFQMAGMNRKLYPDVETVFLT
PADEYMFISATMVREIARLGGDVGKFVQPVVIDRLRRKLNPEQL
NT seq 495 nt   +upstreamnt  +downstreamnt
ttgagacacggcaaggtggtgtatccgggcactttcgatcccatgacccgcggacatgag
gacatcgtgcgccgggccgcgatgctgttcgatcaggtcatcgtcggcgtcgcgcaaagc
gcgggcaaagcgccgattttcaccatggaagagcgggtggagatggcccgcgagattctg
gcgccgtttcccaacgtcacggtgatcggtttcgacggcttgctgatgaattttctccgc
gcgcaagacgcccggctcatcctgcgcggcctgcgcgcggtgtcggactttgagtatgaa
ttccagatggcggggatgaaccgcaagctctacccggacgtggaaacggtttttctgacc
ccggccgatgagtacatgttcatttccgccaccatggtgcgcgaaatcgccaggttgggg
ggcgatgtcggcaagttcgtgcagcctgtcgtgatcgatcggctgcgtcgtaaattgaac
cctgagcaattgtga

DBGET integrated database retrieval system