Rhodocyclaceae bacterium Thauera-like: B4966_02825
Help
Entry
B4966_02825 CDS
T05394
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
rbh
Rhodocyclaceae bacterium Thauera-like
Pathway
rbh00770
Pantothenate and CoA biosynthesis
rbh01100
Metabolic pathways
rbh01240
Biosynthesis of cofactors
Module
rbh_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
rbh00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
B4966_02825
Enzymes [BR:
rbh01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
B4966_02825
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
AUL99233
LinkDB
All DBs
Position
complement(596496..596990)
Genome browser
AA seq
164 aa
AA seq
DB search
MRHGKVVYPGTFDPMTRGHEDIVRRAAMLFDQVIVGVAQSAGKAPIFTMEERVEMAREIL
APFPNVTVIGFDGLLMNFLRAQDARLILRGLRAVSDFEYEFQMAGMNRKLYPDVETVFLT
PADEYMFISATMVREIARLGGDVGKFVQPVVIDRLRRKLNPEQL
NT seq
495 nt
NT seq
+upstream
nt +downstream
nt
ttgagacacggcaaggtggtgtatccgggcactttcgatcccatgacccgcggacatgag
gacatcgtgcgccgggccgcgatgctgttcgatcaggtcatcgtcggcgtcgcgcaaagc
gcgggcaaagcgccgattttcaccatggaagagcgggtggagatggcccgcgagattctg
gcgccgtttcccaacgtcacggtgatcggtttcgacggcttgctgatgaattttctccgc
gcgcaagacgcccggctcatcctgcgcggcctgcgcgcggtgtcggactttgagtatgaa
ttccagatggcggggatgaaccgcaagctctacccggacgtggaaacggtttttctgacc
ccggccgatgagtacatgttcatttccgccaccatggtgcgcgaaatcgccaggttgggg
ggcgatgtcggcaagttcgtgcagcctgtcgtgatcgatcggctgcgtcgtaaattgaac
cctgagcaattgtga
DBGET
integrated database retrieval system