KEGG   Rhodocyclaceae bacterium Thauera-like: B4966_03200
Entry
B4966_03200       CDS       T05394                                 
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
rbh  Rhodocyclaceae bacterium Thauera-like
Pathway
rbh00190  Oxidative phosphorylation
rbh01100  Metabolic pathways
rbh02020  Two-component system
Module
rbh_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:rbh00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B4966_03200
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B4966_03200
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    B4966_03200
Enzymes [BR:rbh01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     B4966_03200
SSDB
Motif
Pfam: Rieske UCR_Fe-S_N
Other DBs
NCBI-ProteinID: AUM01417
LinkDB
Position
676196..676786
AA seq 196 aa
MSVDQKMDSGRRTLLLATSAAGGAAAVATAVPFVASLTPSERAKAAGAPVEADVSKLAPG
EMMTVEWRGKPVWILRRTPEMLASLDKTDALVSDPESNKPMQPDYAKNKHRSIKPEYLVA
VGICTHLGCSPSEKFKPGAESGLGADWPGGFLCPCHGSQFDLAGRVYRSMPAPDNLEVPP
HKYLAESLLLIGEDKA
NT seq 591 nt   +upstreamnt  +downstreamnt
atgagcgttgatcaaaaaatggacagcggccgccgcaccttgctgttggcgacgtcggcc
gcaggcggggcagccgccgtggcaacggcagtgccgtttgtcgccagcctgacgccatcg
gagcgcgcaaaagcggccggtgcgccggtcgaagccgacgtgagcaagctcgcgccgggt
gaaatgatgaccgtggagtggcggggcaagccggtgtggattttgcggcgcacgcccgag
atgctggcgtcgctggataaaaccgatgcgttggtgtccgacccggagtccaacaagccg
atgcagccggattacgccaagaacaagcatcgctcgatcaagcccgaatatctggtggcg
gtgggcatttgcacccacctgggctgttcgccatccgaaaagttcaagcccggtgccgag
agcggtttaggcgctgactggcccggcggtttcctgtgcccgtgccatggctcgcagttc
gacctggccggtcgtgtctatcgcagcatgcctgcgccagacaatctcgaagtgccgccg
cacaagtacctggcggaatccctgcttctcatcggtgaagacaaggcgtaa

DBGET integrated database retrieval system