KEGG   Rhodocyclaceae bacterium Thauera-like: B4966_05350
Entry
B4966_05350       CDS       T05394                                 
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rbh  Rhodocyclaceae bacterium Thauera-like
Pathway
rbh00260  Glycine, serine and threonine metabolism
rbh00750  Vitamin B6 metabolism
rbh01100  Metabolic pathways
rbh01110  Biosynthesis of secondary metabolites
rbh01120  Microbial metabolism in diverse environments
rbh01230  Biosynthesis of amino acids
Module
rbh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rbh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B4966_05350
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B4966_05350
Enzymes [BR:rbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B4966_05350
SSDB
Motif
Pfam: Thr_synth_N PALP THR4_C Gp_UL130
Other DBs
NCBI-ProteinID: AUM01465
LinkDB
Position
1135392..1136834
AA seq 480 aa
MKYLSTRGHAGRPEFCDILLGGLAPDGGLYLPETYPQVSRAELDAWRKLSYAELAYEILS
KFITDIPAADLKAICDKTYTPAVFCHARPGDDPADITPVHWLEPGKLGLLELSNGPTLAF
KDMAMQLLGNLFEYVLGKRGQRLNILGATSGDTGSAAEYAMRGKRGVRVFMLSPHGLMSP
FQRAQMYSLQDENIFNIAITGMFDDAQDIVKAVSNDAAFKARYHIGAVNSINWARVAAQI
VYYFKGYFGATESNDQQVAFCVPSGNFGNICAGHIARMMGLPVARLILATNENDVLDEFF
RTGVYRPRKAAETRVTSSPSMDISKASNFERFVFDLVGRDPQKVAALWAEVDAGRPFDLS
SSADFARIDDFAFVSGSSTHADRLATIRKVFAQYQVMIDTHTADGVKVAWSCADRIPAGV
PVLVLETALPAKFADTIREALGREPERPAALEGIERLPQRVEVMAPDVEAVKRFIAEHVD
NT seq 1443 nt   +upstreamnt  +downstreamnt
gtgaaatatctttccacccgcggccatgccggccggcccgaattctgcgacatcctgctc
ggcggcctcgcgccggacggcggcctctacttgccggaaacctacccgcaggtcagtcgc
gccgaactggacgcttggcgcaagctttcctacgccgagctggcctacgaaattttgtcc
aaattcatcaccgacattcctgcggccgatctgaaagcgatctgcgacaaaacttatacg
cccgcagtcttttgccatgcccgcccgggcgacgatccggccgacatcaccccggtacat
tggctggagccgggcaaattgggcttgctggagctgtccaacggtccgacgctggctttc
aaggacatggccatgcaactgctcggcaatttgttcgagtatgtgctgggcaagcgcggg
cagcgcctcaacatcctcggtgcgacctcgggcgataccggctcggcggccgaatatgcg
atgcgcggcaagcgcggtgtgcgggtgttcatgctgtcgccgcatgggctgatgagtccg
ttccagcgtgcgcagatgtattcgttgcaagatgaaaacatcttcaacatcgccattacc
ggcatgttcgacgacgcccaggacatcgtcaaagcggtctccaatgatgccgctttcaag
gcgcgatatcacattggtgcggtcaattcgatcaactgggcgcgggtggcggcgcaaatc
gtctattacttcaaaggctatttcggcgcgaccgagtccaacgaccagcaagtggctttt
tgcgtgccatcgggcaacttcggcaacatctgcgccgggcacattgcgcgcatgatgggc
ttgccggtggcgcggctgattctggccaccaatgaaaacgacgtgctcgacgaatttttc
cgcaccggcgtctatcgtccgcgtaaggctgccgagacgcgtgtcacctctagtccgtcg
atggacatttccaaggcgtcgaacttcgagcgcttcgttttcgatctggtcgggcgcgat
ccgcagaaagtcgctgcactgtgggcggaagtggatgcggggcgtccgttcgatttgtcc
tcgtcggccgactttgcccgcatcgacgattttgcctttgtctctgggtcgagtacgcat
gccgatcggctggccaccattcgcaaggtattcgcgcagtaccaggtgatgatcgacacg
cacaccgccgatggggtgaaagtggcgtggtcgtgtgcggatcggattccggcgggcgtg
ccggtgctggtgctggaaaccgctctgccggccaagtttgccgacaccatccgcgaagcg
ctcggccgcgagccggagcgtccggccgctctcgaaggcatcgagcgcctgccacagcgt
gtcgaggtcatggcaccggacgttgaagcggtcaagcgtttcatcgccgagcacgtggac
tga

DBGET integrated database retrieval system