Rhodocyclaceae bacterium Thauera-like: B4966_05415 Help Entry B4966_05415       CDS       T05394                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism rbh  Rhodocyclaceae bacterium Thauera-like Brite KEGG Orthology (KO) [BR:rbh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rbh03032]     B4966_05415    03036 Chromosome and associated proteins [BR:rbh03036]     B4966_05415    03400 DNA repair and recombination proteins [BR:rbh03400]     B4966_05415 DNA replication proteins [BR:rbh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     B4966_05415 Chromosome and associated proteins [BR:rbh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     B4966_05415 DNA repair and recombination proteins [BR:rbh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       B4966_05415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_bac_1 DUF937 HTH_10 H2TH Motif Other DBs NCBI-ProteinID:  AUL99662 UniProt:  A0A2K9L933 LinkDB All DBs Position 1154680..1154952 Genome browser AA seq 90 aa AA seqDB search MNKSELIDEIAAEAGISKTAAGKALDAALAAVKQALKDNDTVTLVGFGAFYVSERAARAG RNPQTGQSIEIKAAKVPKFRPGKALKDALN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtcggaactgatcgatgaaatcgcggccgaggccgggatatccaaaactgcc gccggcaaggcgctcgacgccgccctggctgcggtcaagcaggccctcaaggacaatgac acggtgaccctggtgggtttcggggccttttatgtaagcgaacgtgccgcgcgcgccggg cgtaacccgcaaaccggccaaagcatcgagatcaaggcggccaaggtacctaaatttcgc cctggcaaggcgctcaaagatgcgctaaactaa

DBGET integrated database retrieval system