Rhodocyclaceae bacterium Thauera-like: B4966_05880 Help Entry B4966_05880       CDS       T05394                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rbh  Rhodocyclaceae bacterium Thauera-like Pathway rbh01100   Metabolic pathways rbh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rbh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B4966_05880    00074 Mycolic acid biosynthesis     B4966_05880   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B4966_05880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  AUL99740 UniProt:  A0A2K9L9G8 LinkDB All DBs Position 1254078..1254317 Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNESEIKNESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVTAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgaacagcgcgtcaagaagatcgtcgctgagcaacttggcgtgaacgaa tcggagatcaagaacgagtcttcgttcgtggacgatctgggcgcggattcgctggacacc gtggaactggtcatggcgctggaagaagaattcgagtgcgagattccggacgaggaagcc gagaagatcaccactgttcagcaggcgatcgactacgtcactgctcatctgaagaagtaa

DBGET integrated database retrieval system