Rhizobium binxianense: PO860_05460 Help Entry PO860_05460       CDS       T11088                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rbin  Rhizobium binxianense Pathway rbin01100   Metabolic pathways rbin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rbin00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PO860_05460    00074 Mycolic acid biosynthesis     PO860_05460   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PO860_05460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  WEA61318 LinkDB All DBs Position 1092700..1092936 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgatcatcttggcgtcgatgcc gacaaggtcgtcgagagcgccagctttatcgacgatctgggcgctgactcgctcgacacg gtcgaacttgtcatggctttcgaagaagaattcggcgttgaaattcctgacgacgctgcc gactcgatcctgacggtcggcgatgccgtgaagtttatcgagaaggcccaggcctga

DBGET integrated database retrieval system