Rhodopseudomonas boonkerdii: E0H22_12160 Help Entry E0H22_12160       CDS       T07799                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rbk  Rhodopseudomonas boonkerdii Pathway rbk01100   Metabolic pathways rbk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rbk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E0H22_12160    00074 Mycolic acid biosynthesis     E0H22_12160   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E0H22_12160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  UGV26377 LinkDB All DBs Position 2647388..2647627 Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPEKVIDSASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgagattggcgagcgagtgaagaagatcgtggtcgaacaccttggtgtcgagccc gagaaggtgatcgattccgcgagcttcatcgatgatctcggcgctgacagcctcgacacg gtcgagctcgtgatggcgttcgaagaagagttcggctgcgagattccggacgatgctgcc gagacgattctgaccgtcggcgatgcgaccaagttcctcgagaagaatgccaagagctaa

DBGET integrated database retrieval system