Pseudogemmobacter blasticus: B6K69_17630
Help
Entry
B6K69_17630 CDS
T05669
Name
(GenBank) plasmid partitioning protein RepB
KO
K03497
ParB family transcriptional regulator, chromosome partitioning protein
Organism
rbl
Pseudogemmobacter blasticus
Brite
KEGG Orthology (KO) [BR:
rbl00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
rbl03000
]
B6K69_17630
03036 Chromosome and associated proteins [BR:
rbl03036
]
B6K69_17630
09183 Protein families: signaling and cellular processes
04812 Cytoskeleton proteins [BR:
rbl04812
]
B6K69_17630
Transcription factors [BR:
rbl03000
]
Prokaryotic type
Other transcription factors
Others
B6K69_17630
Chromosome and associated proteins [BR:
rbl03036
]
Prokaryotic type
Chromosome partitioning proteins
Other chromosome partitioning proteins
B6K69_17630
Cytoskeleton proteins [BR:
rbl04812
]
Prokaryotic cytoskeleton proteins
MinD / ParA class of bacterial cytoskeletal proteins
B6K69_17630
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
RepB
ParBc
Motif
Other DBs
NCBI-ProteinID:
AWD23714
LinkDB
All DBs
Position
pRsa:84957..85934
Genome browser
AA seq
325 aa
AA seq
DB search
MSRKDVLKGLMDAQPATPAGPVAAPPRANRGAIGAVSRSIADLKARSVVELDPHSIEAAG
MSDRLETDLDADASLRNSIAEYGQQVPVLVRPHPTKEGRYQIVYGRRRVLAMRDLGQTVK
ALIRDLDDRELVLAQGQENTARRDLSFIEKVNFARQLSEAGYDRKVICDALSVDKTLISR
MLSIADRLPPDLIAGIGAAPSVGRDRWLALADLVEATETDTITLLAMVNLGTVSERSDDR
FQTAWAYLSGVMARRKAVPESTRRPAQPLYTPDGVPLGQARYDRNFCTVKLRLAHSEGFE
DWLVENLPTLFTDWQARNTGPARKP
NT seq
978 nt
NT seq
+upstream
nt +downstream
nt
atgtcacgcaaggatgtgttgaagggcctgatggacgcccagcctgccacgcccgccggc
cccgtggcggccccgccccgtgccaatcgcggcgccatcggggcggtctcgcggtcgatc
gccgatctcaaggcccggtcggtggttgagcttgatccccacagtatcgaggcggccggc
atgtcggaccggctggaaaccgaccttgacgccgatgcctcgctgcgcaattccattgcc
gaatatggccagcaggtgccggttctggtgcgcccccaccccacgaaagagggccgctat
cagattgtctacggccgccgccgcgtgctggcgatgcgcgatctgggccagacggtcaag
gcgctgatccgcgatctggacgaccgcgaactggtgcttgcgcaggggcaggaaaacacc
gcccggcgggatctgtccttcatcgagaaggtgaacttcgcccgccagctcagcgaggcc
ggctatgaccgcaaggtcatctgcgacgcgctttccgtggacaagacgctgatcagccgg
atgctgtcgattgccgaccgcctgccccccgatctgatcgccggcatcggggcggcgccc
tcggtcgggcgcgaccgctggcttgcgctggccgatctggtcgaggccaccgaaaccgat
accatcacccttctggcgatggtcaaccttggaaccgtctcggaacggtctgacgacagg
tttcagacggcctgggcctatctgtcgggggtgatggcgcgccgcaaggccgtgcccgaa
agcacccgccgcccggcgcagccgctgtacacccccgacggggtgccgctgggacaggcc
cggtatgaccgcaacttctgcacggtcaagctgcggctggcccatagcgaaggcttcgag
gattggctggttgaaaacctgccgacgctgttcaccgattggcaggcccgcaacacgggc
cctgccaggaaaccctga
DBGET
integrated database retrieval system