KEGG   Pseudogemmobacter blasticus: B6K69_17630
Entry
B6K69_17630       CDS       T05669                                 
Name
(GenBank) plasmid partitioning protein RepB
  KO
K03497  ParB family transcriptional regulator, chromosome partitioning protein
Organism
rbl  Pseudogemmobacter blasticus
Brite
KEGG Orthology (KO) [BR:rbl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbl03000]
    B6K69_17630
   03036 Chromosome and associated proteins [BR:rbl03036]
    B6K69_17630
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rbl04812]
    B6K69_17630
Transcription factors [BR:rbl03000]
 Prokaryotic type
  Other transcription factors
   Others
    B6K69_17630
Chromosome and associated proteins [BR:rbl03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    B6K69_17630
Cytoskeleton proteins [BR:rbl04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   B6K69_17630
SSDB
Motif
Pfam: RepB ParBc
Other DBs
NCBI-ProteinID: AWD23714
LinkDB
Position
pRsa:84957..85934
AA seq 325 aa
MSRKDVLKGLMDAQPATPAGPVAAPPRANRGAIGAVSRSIADLKARSVVELDPHSIEAAG
MSDRLETDLDADASLRNSIAEYGQQVPVLVRPHPTKEGRYQIVYGRRRVLAMRDLGQTVK
ALIRDLDDRELVLAQGQENTARRDLSFIEKVNFARQLSEAGYDRKVICDALSVDKTLISR
MLSIADRLPPDLIAGIGAAPSVGRDRWLALADLVEATETDTITLLAMVNLGTVSERSDDR
FQTAWAYLSGVMARRKAVPESTRRPAQPLYTPDGVPLGQARYDRNFCTVKLRLAHSEGFE
DWLVENLPTLFTDWQARNTGPARKP
NT seq 978 nt   +upstreamnt  +downstreamnt
atgtcacgcaaggatgtgttgaagggcctgatggacgcccagcctgccacgcccgccggc
cccgtggcggccccgccccgtgccaatcgcggcgccatcggggcggtctcgcggtcgatc
gccgatctcaaggcccggtcggtggttgagcttgatccccacagtatcgaggcggccggc
atgtcggaccggctggaaaccgaccttgacgccgatgcctcgctgcgcaattccattgcc
gaatatggccagcaggtgccggttctggtgcgcccccaccccacgaaagagggccgctat
cagattgtctacggccgccgccgcgtgctggcgatgcgcgatctgggccagacggtcaag
gcgctgatccgcgatctggacgaccgcgaactggtgcttgcgcaggggcaggaaaacacc
gcccggcgggatctgtccttcatcgagaaggtgaacttcgcccgccagctcagcgaggcc
ggctatgaccgcaaggtcatctgcgacgcgctttccgtggacaagacgctgatcagccgg
atgctgtcgattgccgaccgcctgccccccgatctgatcgccggcatcggggcggcgccc
tcggtcgggcgcgaccgctggcttgcgctggccgatctggtcgaggccaccgaaaccgat
accatcacccttctggcgatggtcaaccttggaaccgtctcggaacggtctgacgacagg
tttcagacggcctgggcctatctgtcgggggtgatggcgcgccgcaaggccgtgcccgaa
agcacccgccgcccggcgcagccgctgtacacccccgacggggtgccgctgggacaggcc
cggtatgaccgcaacttctgcacggtcaagctgcggctggcccatagcgaaggcttcgag
gattggctggttgaaaacctgccgacgctgttcaccgattggcaggcccgcaacacgggc
cctgccaggaaaccctga

DBGET integrated database retrieval system