KEGG   Rhizobiales bacterium NRL2: TEF_06030
Entry
TEF_06030         CDS       T04419                                 
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
rbm  Rhizobiales bacterium NRL2
Brite
KEGG Orthology (KO) [BR:rbm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rbm03016]
    TEF_06030
Enzymes [BR:rbm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     TEF_06030
Transfer RNA biogenesis [BR:rbm03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    TEF_06030
 Prokaryotic type
    TEF_06030
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 TruB_C DUF3945
Other DBs
NCBI-ProteinID: ANK80400
LinkDB
Position
complement(1314555..1315460)
AA seq 301 aa
MGRRRRGQPVHGWLVLDKPVGPTSTDMVNRARRLLDAQKAGHAGTLDPLASGILPIAFGE
ATKCVPLLNDATKVYRFTVRWGVQTTTDDAEGEALAESDVRPGPSAIDAALTAFTGRIMQ
TPPTFSAIKVNGQRAYDLARAGAPPDLPPREAEIYSLVHLDDPDPDHSRFEMRSGKGVYV
RSLARDLALALGARGHVAELRRTAVGPFRESAAISLDDFVSLCDKRAGLEALSPIETALD
DIPALALTGEQADRLRHGQPVRVLNFTSPEAELLCVMHDRKPVALARYRSEFVEPVRVFN
L
NT seq 906 nt   +upstreamnt  +downstreamnt
atgggacggcgtaggcgcggccagcccgtacatggctggctggtcctcgacaagcccgtg
gggccgacctccaccgacatggtcaatcgcgcccggcggctgctggacgcgcagaaggcg
ggccatgccggcaccctcgatccgctggccagcggcatcctgcccatcgctttcggcgag
gccacgaaatgcgtgccgttgctgaacgacgccacgaaggtctatcgcttcaccgtgcgc
tggggcgtgcagaccacgaccgacgacgccgaaggcgaggctctggccgaaagcgatgtc
cggcccggcccgtccgccatcgacgccgcgctgaccgcgttcaccggccggatcatgcag
actccgccgaccttctccgccatcaaggtgaatggccaacgggcctatgatctggcgcgc
gccggcgccccgccggatctgccgccccgcgaggcggagatctacagcctggtgcatctc
gacgacccggatccggaccacagccgcttcgagatgcggtccggcaagggcgtctatgtg
cgcagcctggcgcgcgatctggccctggcgctcggcgcccgcggccacgtcgccgaactg
cgccgcacggcggtgggtccgttccgcgaaagcgcggcgatttctctggatgatttcgtt
tccctgtgcgataagcgcgccggccttgaggccctgtcaccgatcgagaccgcgctggac
gacatcccggctctggccctgaccggtgagcaggctgacagacttcgtcatggtcagccg
gtccgggtcctcaacttcacgtccccggaggcggaattgctgtgcgtgatgcacgaccgc
aagccggtggcgctggcccgctaccgctcggaattcgtcgagccggtgcgtgtgttcaat
ctctga

DBGET integrated database retrieval system