Rickettsia bellii OSU 85-389: A1I_07355 Help Entry A1I_07355         CDS       T00602                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rbo  Rickettsia bellii OSU 85-389 Pathway rbo01100   Metabolic pathways rbo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rbo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A1I_07355 (acpP)    00074 Mycolic acid biosynthesis     A1I_07355 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A1I_07355 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 DUF1493 OsmC Motif Other DBs NCBI-ProteinID:  ABV79769 UniProt:  A8GY19 LinkDB All DBs Position 1413021..1413266 Genome browser AA seq 81 aa AA seqDB search MSKVDNIEQKVIKIIADNQGKKIEEISVDLRFAEDLGVDSLSTVEIMMEIEKEFGVDVPD EEATKIKKVADVVNYIKEHKS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtaaagtggataatatcgagcagaaagttatcaaaattattgctgataatcaaggg aaaaaaattgaagaaatcagcgtggacttgcgatttgcagaagatttaggagtagatagc ctatctacagtagaaataatgatggaaatagagaaagaatttggtgttgatgttcctgat gaagaagcaactaagataaaaaaagtagcagatgttgttaactatataaaagaacataaa tcttaa

DBGET integrated database retrieval system