Rahnella bonaserana: QNM34_04620 Help Entry QNM34_04620       CDS       T09076                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rbon  Rahnella bonaserana Pathway rbon01100   Metabolic pathways rbon01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rbon00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QNM34_04620    00074 Mycolic acid biosynthesis     QNM34_04620   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QNM34_04620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WHZ41575 LinkDB All DBs Position 1012930..1013184 Genome browser AA seq 84 aa AA seqDB search MQKQEIYQQISALLIKLFEIDENDISPQAKLYEDLELDSIDAVDLVVHLQKITGRKIKPE MFKSVRTVQDVVDAIDELLNTPAS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcagaagcaagaaatttaccagcaaattagcgccttattaatcaagctatttgaaatt gatgaaaatgatatcagtccgcaagcgaagctttatgaggatctggaattagacagcatt gatgctgttgatctggttgttcatttgcaaaagataacgggcagaaagattaaacctgaa atgttcaagtctgtaagaacagttcaggatgttgttgatgcgattgatgaattgctcaac acgcctgcgtcctga

DBGET integrated database retrieval system