KEGG   Rhodobiaceae bacterium SMS8: RHODOSMS8_02752
Entry
RHODOSMS8_02752   CDS       T05596                                 
Symbol
hxuA
Name
(GenBank) heme/hemopexin-binding protein
Organism
rbs  Rhodobiaceae bacterium SMS8
SSDB
Motif
Pfam: TPS DUF4097
Other DBs
NCBI-ProteinID: AWZ02267
LinkDB
Position
complement(2772837..2777621)
AA seq 1594 aa
MKIRPSRRSSCDGVGRVLSGGLLSVAALACAMVGAWAEPTNGTIVAGGGVGASIGSVANG
GGFNVTVQQNSAQMVVNWDDFNINANDAVNFIQPSSSAIAVNRVVGGAVTPTMIDGALSA
NGHVWILDPAGVAFGAGAVVDVGGLLATTSDIDTATFMATDPATGTFTFTQAGTGAVTNT
ADLEAQGLIALVAPMVTNSGSLTSDNGDVLLGGAKAFRLSFAEVDRTPAGGGAVYKELLV
TDFIIDTGVDNAVAPAEAIPVTQTAAGSASGSNIIISAASVGGGAFLNIDGMVEATNVGA
GSGSVMLLGGADLTGGVVAATGTETVRSTDLGVSATGALTVQAGAVSIAASAQDISVGSA
AITAAVGDVSINDAVTATSGAIGITSASGDVTLDAVTATTGAINVTANTGDIDVGATTAG
TTITLSAQDIDLAGKVDATTTAMLTATVGNVSSTGALEIEGSAVTVSGPILAATDATVTA
TATDATLDAVTATTGAVSITANTGNIDVGATTAGSTIILSAQDIDLAGKVDATTTAMLTA
TVGNVSSTGALEIEGSAVTVSGPILAATDATITATATDATLDAVTSTTGAVSITANTGNI
DVGATTAGSTIILSAQDIDLAGKVDATTTAMLTATVGNVSSTGALEIEGSAVTVSGPILA
ATDATITATATDATLDAVTSTTGAVSITANTGNIDVGATTAGTTITLSAQDIDLAGKVDA
TTTAMLTATAGNVSSTGALEIEGSAVTVSGPILAGTDATVTATATDATLDAVTATTGAIN
ITANTGGIDVGATTAGTTITLSAQDINLAGKVDATTTAMLTATVGDVSSTGALEIEGSAV
TVNGPILAGTDATVTATAADATLDAVTATAGVISINAATGNIDVGAATAGTSITLSAQDI
DLAGKVDATTTAMLTATVGDVSSTGALEIEGSAVTVNGPTLGGTSATITATAADATLDAV
TATTGAISITANTGDIDVGATTAGTTITLSAQDIDLAGKVDATTTAMLTATVGNVSSTGA
LEIEGSAVTVSGPVLAATGATITATSGNATLDAVTATTGAIAINAATGDIDVGATMAGTS
ISISGKDIDLAGRLTAGTSASLTATVGDVSSAGKVEIDAGSISLVGRLTAATDVFLTALT
GGISSSGSISATLGDIIANAANGPISVNDLEATGDIRLVGTSVNVAGTATAHGSAFLQAL
TGNVSVGGSVTATGGALVLDASSGSALLNRIGALSDVTLTVADLDLSGSISAGDQFILET
DRSGQTIVLGGDGTTGDVTLRRTAGLIIDESELTKISAGRFDIDGGANDVLLLDARLTTS
SLDTMMIGTDQSSRIIAAGTVTGLTSLQLGYQTASLDRRPELILISGQLGLDTSTGRLGT
VRLESADDIVIGTERFLEIFETESLTLLGLASLPLSVAGGVDDHVFVATEQLQILAPGSV
VQQNTGRGVEGAGLVFNVPSKGDGVLFPSEDGPEEVLIFGEVIRPDGTRVSAFNASLEDN
ILFGGSSTLAEPALIQNGQYYMNFCLIGDPVSCSADSLREIERNNRFINGDPSGLGGVIP
VVFETGENDERDEEEDLGGVAASGNEALWDAGSR
NT seq 4785 nt   +upstreamnt  +downstreamnt
gtgaagatccgtccctctagaaggtcgagctgtgatggcgtcggtcgggtgctgtccggt
ggtctccttagtgttgctgccctggcgtgtgccatggtcggcgcttgggcagagcctacc
aatgggacgattgtcgcgggaggtggtgttggcgcctcaattggttcagttgcaaatggc
ggcgggtttaacgttacggtccagcaaaactccgctcagatggtcgtcaattgggacgac
tttaatatcaacgccaacgatgccgtcaattttatccaaccttcgagctctgcgattgct
gtcaaccgggtagtgggcggcgctgtgacgccaacgatgattgacggtgcactttcggcc
aacggccatgtttggattttggatccggctggcgtcgcctttggcgcgggggcggtggtg
gatgtgggcggcttgttagccaccacgagtgacattgatacagctaccttcatggcgacg
gacccggctacgggcaccttcacattcacgcaggctggaacaggggcggttaccaacacc
gctgatcttgaggcacagggcctgattgccctggtggcgccgatggtcactaattcaggg
tcgctgacatctgacaatggggatgtgctgcttgggggtgcgaaggcgttccgcctcagt
tttgcagaggtcgatcggacaccggcaggtggcggcgctgtctataaggaactgttggtc
accgacttcatcatcgatacaggtgtggacaatgcagtggcacctgctgaggcaatccct
gtcacgcagacggctgctgggagtgcaagtggcagcaacattattatttcagcggcatcg
gtaggcggcggtgctttccttaatattgacggcatggtcgaggcaacgaatgtaggtgct
gggtctgggtcagtgatgttgttaggtggcgcagatctgaccgggggagtagttgcagcg
accggcactgagactgtccgttccacagatctcggtgtcagcgcgacgggcgctttgacg
gttcaggccggggcggtctcaatcgcagccagcgcacaggatatctctgttggatcagct
gccattaccgcggctgtgggagatgtgtcgatcaatgatgcggtaacggcaacgtctgga
gctattgggatcacatcggcctctggtgatgtgacccttgatgcggtgacggcgacgacg
ggggctatcaatgttaccgcgaacacgggcgatattgatgtgggtgcgaccacagctgga
accaccatcaccctgtcggctcaggatattgatcttgcgggcaaggtggatgccacgacg
accgcgatgttgacggcgacggtggggaatgtgtcctcgacaggtgcgctagagattgag
ggttccgcggtgacggtttccggtccgatcctggctgcgactgatgccacagtgaccgcg
acggctaccgacgcaacgcttgatgcggtgacggcgacgacgggcgctgtctcgatcacg
gcaaataccggcaatattgatgtgggtgccaccacagctggctcaaccatcatcctgtcg
gcccaagatattgatctggctggcaaggtggatgcgacgacgacggccatgctgacggcg
acggtaggcaatgtctcgtcgacgggcgcgctggagattgagggttcggcggtgacggtg
tccggtccgatcctggctgcgaccgatgcaacaattacggcgacggctaccgacgcaacg
cttgatgcggtgacatcgacgacgggggctgtctcgatcacggcaaataccggcaatatt
gatgtgggtgccaccacagctggctcaaccatcatcctgtcggcccaagatattgatctg
gctggcaaggtggatgcgacgacgacggccatgctgacggcgacggtaggcaatgtctcg
tcgacgggcgcgctggagattgagggttcggcggtgacggtgtccggtccgatcctggct
gcgaccgatgcaacaattacggcgacggctaccgacgcaacgcttgatgcggtgacatcg
acgacgggggctgtctcgatcacggcaaataccggcaatattgatgtgggtgccaccaca
gccggaaccaccatcaccctgtcggcacaggacattgatctggcgggcaaggtggatgcg
acgacgaccgcgatgttgacggccacggcggggaatgtctcgtcgacgggtgcgctggag
attgagggctccgcggtgacggtttccggtccgatcctggctgggacagatgccacagtg
accgcgacggctaccgacgcaacgcttgatgcggtgacggccaccacgggggctatcaac
attaccgctaacacgggcggtattgatgtgggtgcgaccacagctggaaccaccatcacc
ctgtcggctcaggacattaatcttgcgggcaaggtggatgccacgacgacggccatgctg
acggcgactgtcggcgatgtttcgtcgacgggtgcgctggagattgagggttcggcggtg
acggtcaatggtccgatcctggctgggacagatgccacagtgaccgcgacggctgccgac
gccacgcttgatgcagtgacagcgacggcgggggttatctcgatcaatgcggccacaggc
aatattgatgtgggcgcggcaacggcaggcacgtcgatcaccctgtcggcacaggatatt
gatcttgcgggcaaagtcgatgcgaccacgacagccatgctgacggcgactgtcggcgat
gtttcgtcgaccggcgcgctggagattgagggttccgcggttaccgtcaatggtccaacg
ctgggcgggaccagcgcgacgatcactgcgacggctgccgacgcaacgcttgatgcggtg
acagctacaacgggtgctatctcgatcacagcgaatactggtgacattgatgtgggcgcc
accacagctggaaccaccatcaccctgtcggctcaggatattgatctcgcgggcaaggtg
gatgccacgacgaccgcgatgttgacggcgacggtggggaatgtgtcctcgacgggtgct
ctggaaattgaagggtccgcggtgacggtctcgggtcccgttctggctgcgacaggtgca
acaattacggcgacgtcggggaatgcaactctggatgcggtgacggcgacgactggggct
atcgcgatcaatgcggccacaggcgatattgatgtgggtgcgacgatggcgggcacgtct
atttctatctcaggtaaggatatcgatctggctggcaggttgacggcaggcacttctgcc
tccctgacggcgaccgtcggcgatgtttcatcagctggcaaagttgagattgacgccggc
tctatctccctcgtcggcaggctcacagccgctaccgatgttttcctgacagctctgacc
ggcggcatttcttcgtctggcagcataagtgcgacccttggcgacattattgctaacgcg
gctaacggtccaatttctgtgaatgatctggaagcgaccggagacattcgccttgtcggt
acgtctgtgaatgttgcggggacggcaacggcacatggcagcgcgtttctccaggcgctc
accggcaatgtgtctgtgggcggttcagttacagcgacaggtggtgcgctggttctggat
gcatcaagcggcagcgcgcttctcaatcgaataggcgcgctgagcgatgtcacgctcaca
gttgcggaccttgatctctccgggtcaatttctgctggcgatcagtttattctagagact
gatcgcagtggacagacgattgtgcttggcggtgatggcaccacaggtgacgttaccttg
cggcggaccgcggggcttattattgatgagtcagagcttacaaaaatctctgccggacgt
tttgatatagatggtggagccaatgatgttctgctgctggatgcgcggctcaccacatcc
agcttagatacgatgatgatcgggacggaccagtcctcccgcatcattgccgcgggcacg
gtaaccggcctcacgtcactgcagctcgggtatcaaacagcgagccttgaccgtcggccc
gaattgatcctgatttcaggacaattgggattggatacaagtacggggcgcctggggact
gtcaggcttgaatccgctgatgatatcgtgatcgggactgagaggttccttgagattttt
gaaacagaatccctcacccttctgggtctcgcttcactgccgcttagtgtcgccggtggg
gttgacgatcatgtgtttgttgcgactgaacaattacaaattctggcaccaggctcagtc
gttcaacagaacactgggcgaggtgttgagggggcagggctcgttttcaatgtgccatcg
aaaggtgatggagtcttgttcccgtcagaggatggtcctgaagaggtgcttattttcggc
gaggtcattcggcctgatggcacacgtgtctccgcctttaacgccagcctagaggacaat
attctctttggcggcagctcgacgttggcggaaccggcgctcatccagaacggtcagtac
tacatgaatttctgtctcattggtgatccggtgagttgttctgcagactcccttcgagag
attgagcggaataatcgatttatcaatggcgatccatcaggtctgggcggggtgattcct
gtcgtttttgagaccggtgaaaatgatgagcgcgacgaggaagaggatctcggtggggtt
gccgctagcggtaatgaagccctatgggatgcggggagccgatga

DBGET integrated database retrieval system