Rugosibacter aromaticivorans: PG1C_03835 Help Entry PG1C_03835        CDS       T03689                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism rbu  Rugosibacter aromaticivorans Pathway rbu03430   Mismatch repair Brite KEGG Orthology (KO) [BR:rbu00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     PG1C_03835  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:rbu03400]     PG1C_03835 Enzymes [BR:rbu01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      PG1C_03835 DNA repair and recombination proteins [BR:rbu03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      PG1C_03835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S DUF436 Motif Other DBs NCBI-ProteinID:  AJP47833 UniProt:  A0A0C5J7W7 LinkDB All DBs Position complement(755726..755992) Genome browser AA seq 88 aa AA seqDB search MKTTPKKSSTLIESQSFEDALTELEGIISAMEVGQMPLQEALDIYKRGIFLLRQCQETLN AAEQQIRILEDNTLRPLKPDTLGELEDK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaaaactaccccgaaaaaatcctctacgctgatagaatcgcaatctttcgaagacgct ctcactgaactggaaggcatcatcagtgccatggaagttggtcagatgccgctccaagaa gcactggatatctacaaacgtggaatatttttgcttcgccagtgccaagaaactctcaat gcagccgagcagcaaatacgtatccttgaagacaatactctgcgccccctcaagccagac accctcggtgaactggaagataaatag

DBGET integrated database retrieval system