Rugosibacter aromaticivorans: PG1C_10935 Help Entry PG1C_10935        CDS       T03689                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rbu  Rugosibacter aromaticivorans Pathway rbu01100   Metabolic pathways rbu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rbu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PG1C_10935    00074 Mycolic acid biosynthesis     PG1C_10935   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PG1C_10935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AJP48806 UniProt:  A0A0C5JN45 LinkDB All DBs Position complement(2232111..2232374) Genome browser AA seq 87 aa AA seqDB search MNIEKEVLMLLDTTLGLRGRGLAFVPETRLLGALPEFDSMTIINLVTGLEERFGVLVADD EIEGRLFATVGSLLDFVRHKVGPPQAQ NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgaatattgaaaaagaagtgctgatgcttcttgatacaacgctcggtttgcgtggcaga gggttggcctttgtgccagagacgcgcttgctgggcgcgttaccggaattcgattcgatg acgattatcaatctcgtcaccgggctggaagaacggtttggtgtactggttgccgacgat gaaattgaaggccgcctgtttgctacggtgggctcactgctggactttgtgcggcataaa gttggcccgccgcaggcgcagtag

DBGET integrated database retrieval system