Rhizobium brockwellii: RLCC275e_06070 Help Entry RLCC275e_06070    CDS       T09359                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rbw  Rhizobium brockwellii Pathway rbw01100   Metabolic pathways rbw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rbw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RLCC275e_06070    00074 Mycolic acid biosynthesis     RLCC275e_06070   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RLCC275e_06070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  QJX04534 LinkDB All DBs Position 1181587..1181823 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgatcatcttggcgttgatgcc gacaaggtcgtcgagagcgccagctttatcgacgatctgggcgctgactcgctcgacacg gtcgaacttgtcatggctttcgaagaagaattcggcgttgaaattcctgacgacgctgcc gactcgatcctgacggtcggcgatgcagtgaagttcattgagaaggcccaggcctga

DBGET integrated database retrieval system