KEGG   Roseiflexus castenholzii: Rcas_1132
Entry
Rcas_1132         CDS       T00585                                 
Name
(GenBank) translation initiation factor IF-2
  KO
K02519  translation initiation factor IF-2
Organism
rca  Roseiflexus castenholzii
Brite
KEGG Orthology (KO) [BR:rca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rca03012]
    Rcas_1132
   03029 Mitochondrial biogenesis [BR:rca03029]
    Rcas_1132
Translation factors [BR:rca03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    Rcas_1132
 Prokaryotic type
   Rcas_1132
Mitochondrial biogenesis [BR:rca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Rcas_1132
SSDB
Motif
Pfam: IF-2 GTP_EFTU EF-G_D2 MMR_HSR1 IF2_N GTP_EFTU_D2 Ras FeoB_N Arf SRPRB Roc GTP_EFTU_D4 MMR_HSR1_Xtn ATP_bind_1
Other DBs
NCBI-ProteinID: ABU57231
UniProt: A7NID1
LinkDB
Position
complement(1465783..1467999)
AA seq 738 aa
MNSMRISGHQSAVDARDHIEFAGGGRGPGNPGGGRGPGSPGGGRGPGSPGGGRGPGSPGG
GRGPGSPGGGRGPGSPGGGRGPGSPGGGRGPGGGRGPSGGRGGDGRRREESPTDHEDGRI
NRSGRSTSTTTTRTSSTLARPTTVRAPVRPKGPIALPVTMTVREFSEATGVGAAEILKAL
LKAGVVANINQQIDYETAAVIAADFGIETVEYVPPQLEGIVENIRDVLAAQDPKDLKPRP
PVVTIMGHVDHGKTKLLDAIRSTRVAESEAGGITQHIGAYQVELHGRKITFLDTPGHEAF
TAMRARGAQVTDIVVLVVAADDGVMPQTLEAISHVKAAGVPMIVAINKIDAPNANPDRVR
QQLANAGVIVEQFGGDVPSVEVSAKLKKNIDGLLEMILLVADLNEYKANPNAPAVGTIVE
AEMDRTRGPVATVLVQNGTLRLEDNVLVGATTGTIRTMFNDAGKRLRFAEPATPVVILGL
NDVPQAGDILQVMPDLTVAREIALQRQRKQRLEAMASTRGVSLDGLFSSIQQGKIKELNI
ILKADVQGSIGAIEHALSQLNTDEVQIRIIHRGTGTITESDVNLAIASHAIIIGFNARPD
PAARRQAEQYGVDIRFYNIIYQLTEDIKKAMIGMLEPEYREVTEGFAEVRTTFRLPTREI
VAGLYVTEGKITRQYNVRVLRNGVVIHDGKIASLKRFKDDVREVQAGYECGLIVEGFNDI
TPGDTMEFYRRERVERTV
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgaatagtatgagaatctctgggcatcagagcgctgttgatgcgcgcgatcatatcgag
ttcgctggcggcgggcgtggtcccggcaaccctggcggcgggcgcggtcccggcagcccc
ggcggcgggcgcggtcccggcagccccggcggtggacgcggtcccggcagccccggcggc
gggcgtggtcccggcagccccggcggcgggcgtggtcccggcagccccggcggcggacgc
ggtcccggcagccccggcggcgggcgtggtccaggtggcgggcgcggtccgagcggtgga
cgtggcggcgatggacggcgacgcgaggaaagcccaaccgaccatgaagacgggcgcatc
aatcggagcggacgcagcacaagcacaactacaacgcggacttcgagcaccctggcgcgc
ccaacgacagtgcgcgctccggtgcggccaaaaggtccgattgcgctgccggtgacgatg
accgtgcgcgagttttcggaagcgaccggcgttggcgctgccgaaatcttgaaagcactg
ctcaaggctggcgtggtcgccaatatcaatcagcagatcgattacgaaacggcagcggtt
attgcagccgatttcggcatcgaaaccgtggaatatgtgccgccacagttggaggggatc
gtcgagaatatccgtgatgtgctcgccgcgcaggacccaaaggacctgaagccgcgtccg
ccggtggtgacgattatggggcacgtcgaccatgggaagacaaaactgctcgacgcgatc
cgttcgacccgcgtggcggagagcgaagcgggtggcattacccagcatattggcgcgtat
caggtcgaattacacggacgaaagatcaccttcctcgatacgccggggcacgaggcgttc
acggcgatgcgtgcgcgcggtgcgcaggtgaccgacatcgtcgtgttggtggtggctgcc
gacgatggcgtgatgccgcaaaccctcgaggcgatttcgcacgtgaaagcggcgggtgtg
ccgatgatcgtggcgatcaataagatcgacgcgccgaacgccaaccctgatcgcgttcgc
cagcaactcgctaatgcgggggtgatcgtcgagcagtttggcggtgatgtgccatcggtc
gaagtttccgccaaactgaaaaagaatatcgacggattgctcgaaatgatcctgctcgtc
gcggatcttaatgagtacaaagcgaacccgaatgcgcccgccgtcggcacaatcgtcgag
gctgaaatggaccgcacgcgcggtccggtggcgacggtgctcgtgcagaatggcacgctg
cgccttgaggataatgtgctggttggagcgacgaccggcacgatccgcacgatgttcaac
gatgccgggaaacgcctgcgctttgccgaaccggctacaccggtggttattctgggattg
aacgatgtgccgcaggcgggtgatattctccaggtgatgcccgatctgacggttgctcgt
gagattgccctgcaacggcagcgcaagcagcgcctcgaagcaatggcaagcacgcgcggc
gtcagcctcgatgggttgttcagctcgatccagcaggggaagatcaaggagctgaacatc
attttgaaggcggatgtgcagggatcgatcggcgctatcgaacacgcgctgagccaactc
aataccgatgaggtgcagatcaggattatccatcgtggcaccggcaccattaccgaaagc
gatgtcaaccttgcgattgcatcacacgcaatcatcattgggttcaatgcccgccccgat
ccggcggcacgccggcaggctgaacagtatggggtcgatatccggttctacaacattatt
taccagttgaccgaagatatcaaaaaggcgatgatcggcatgctggaaccggagtaccgc
gaggtgaccgaagggtttgccgaggtgcgcaccaccttccgcctgccgacgcgtgagatc
gtggccgggctgtatgtgaccgagggtaagattacgcgccagtacaatgtgcgcgtgctg
cgcaacggcgtcgtgattcacgatggcaagatcgccagcctgaaacgcttcaaagacgat
gttcgcgaagttcaggcaggatatgagtgtggtctgattgtcgaagggttcaacgatatt
acacctggcgatacgatggagttctatcgcagggagcgcgtggaacgcaccgtatga

DBGET integrated database retrieval system